Protein Info for RS_RS04010 in Ralstonia solanacearum GMI1000

Annotation: purine nucleoside permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 368 signal peptide" amino acids 1 to 43 (43 residues), see Phobius details PF06516: NUP" amino acids 56 to 366 (311 residues), 427.7 bits, see alignment E=1.3e-132

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc0798)

Predicted SEED Role

"Purine nucleoside permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y192 at UniProt or InterPro

Protein Sequence (368 amino acids)

>RS_RS04010 purine nucleoside permease (Ralstonia solanacearum GMI1000)
MSVLSEQVDGRPPQPPSGRRGKRWLRAIAAGALLAAGGGASTQPVAQQAPQSHARKVKVL
IISMFAPEAQPWIDKLGLTQAVPVPGLSIDYPSVHCNASDVCQLTTGMGKANAASSVSAL
IHSGQFDLSRAYFLVAGIAGIDPSQGTLGTAAWARYLVDSDLAWEIDAREVPADWPNGFI
GINTQGPGQKPPLNYKTEIFRVNEALLQKALALSKGAVLDDNATARAYRANYPSAPANQP
PAVVQCDTAAGNTYWHGALLGQREAAWVKLLTDGQGTYCTTQQEDNATFEALTRGSKAGL
LDLQRVAVLRTASNFDRPYPGQTPYDSLVGSNSGGFVPSLNNLYLAGGPLVNDIVTRWSV
WKHGVPSP