Protein Info for RS_RS03820 in Ralstonia solanacearum GMI1000
Annotation: tryptophan 2,3-dioxygenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 100% identical to T23O1_RALSO: Tryptophan 2,3-dioxygenase 1 (kynA1) from Ralstonia solanacearum (strain GMI1000)
KEGG orthology group: K00453, tryptophan 2,3-dioxygenase [EC: 1.13.11.11] (inferred from 100% identity to rso:RSc0758)Predicted SEED Role
"Tryptophan 2,3-dioxygenase (EC 1.13.11.11)" in subsystem Aromatic amino acid degradation or NAD and NADP cofactor biosynthesis global (EC 1.13.11.11)
MetaCyc Pathways
- L-tryptophan degradation I (via anthranilate) (3/3 steps found)
- NAD de novo biosynthesis II (from tryptophan) (7/9 steps found)
- superpathway of NAD biosynthesis in eukaryotes (10/14 steps found)
- 3-hydroxy-4-methyl-anthranilate biosynthesis II (3/5 steps found)
- L-tryptophan degradation to 2-amino-3-carboxymuconate semialdehyde (3/5 steps found)
- L-tryptophan degradation IX (8/12 steps found)
- L-tryptophan degradation XII (Geobacillus) (8/12 steps found)
- 3-hydroxy-4-methyl-anthranilate biosynthesis I (2/6 steps found)
- L-tryptophan degradation III (eukaryotic) (7/15 steps found)
- L-tryptophan degradation XI (mammalian, via kynurenine) (8/23 steps found)
- superpathway of aromatic compound degradation via 3-oxoadipate (15/35 steps found)
- superpathway of aromatic compound degradation via 2-hydroxypentadienoate (14/42 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.13.11.11
Use Curated BLAST to search for 1.13.11.11
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8Y1D2 at UniProt or InterPro
Protein Sequence (278 amino acids)
>RS_RS03820 tryptophan 2,3-dioxygenase (Ralstonia solanacearum GMI1000) MHGAQAESWHDAQMDFSKSMSYGDYLALDQILNAQHPRSPDHNEMLFIVQHQTTELWMKL MLHELRAARDCVRNDDLPPAFKMLARVSRIMDQLVQAWNVLATMTPPEYSAMRPHLGQSS GFQSYQYREIEFILGNKNAAMLQPHAHQPEHYAQVKAALETPSLYDEAIRYMARHGFAFD ADCIERDWSRPVTYNASVEAAWLEVYRDPTHHWELYELAEKFVDLEDAFRQWRFRHVTTV ERVIGFKRGTGGTEGVNYLRKMLDVVLFPELWKLRTDL