Protein Info for RS_RS03805 in Ralstonia solanacearum GMI1000

Annotation: NCS2 family permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 455 transmembrane" amino acids 35 to 55 (21 residues), see Phobius details amino acids 63 to 83 (21 residues), see Phobius details amino acids 89 to 108 (20 residues), see Phobius details amino acids 114 to 135 (22 residues), see Phobius details amino acids 145 to 164 (20 residues), see Phobius details amino acids 182 to 203 (22 residues), see Phobius details amino acids 210 to 230 (21 residues), see Phobius details amino acids 232 to 232 (1 residues), see Phobius details amino acids 258 to 279 (22 residues), see Phobius details amino acids 305 to 327 (23 residues), see Phobius details amino acids 339 to 360 (22 residues), see Phobius details amino acids 367 to 388 (22 residues), see Phobius details amino acids 394 to 423 (30 residues), see Phobius details amino acids 434 to 454 (21 residues), see Phobius details PF00860: Xan_ur_permease" amino acids 33 to 415 (383 residues), 227.7 bits, see alignment E=1.1e-71

Best Hits

Swiss-Prot: 71% identical to GHXQ_ECOLI: Guanine/hypoxanthine permease GhxQ (ghxQ) from Escherichia coli (strain K12)

KEGG orthology group: K06901, putative MFS transporter, AGZA family, xanthine/uracil permease (inferred from 100% identity to rso:RSc0755)

MetaCyc: 71% identical to guanine/hypoxanthine transporter GhxQ (Escherichia coli K-12 substr. MG1655)
TRANS-RXN0-562; TRANS-RXN0-578

Predicted SEED Role

"Xanthine/uracil permease family protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y1D5 at UniProt or InterPro

Protein Sequence (455 amino acids)

>RS_RS03805 NCS2 family permease (Ralstonia solanacearum GMI1000)
MASATARDAAGFADARAVDRYFQITARGSTHRREVVAGITTFMAMVYAVFVVPGMLGKAG
FDTSAVFVAVCLTTAFGSLLMGLWARLPIAIGCAISLTAFMGFGLVLGQHLTPGVALGAV
FLMGMVFTAISITGVRSWILRNLPAGVAHGAGIGIGLFLLLIASNDVGLVVKNPGPGLPV
SLGHITAFPAVMSVLGLAAIFGLERRRVPGGILIVIVAVSALGLLLDPAVKFTGVFALPS
LSAPGHAPLIGAMDLRGALSAAVLPSVLALVMTAVFDATGTIRAVAGQAGLLDGKGHIRN
GGRALTADSISSMVSAFFGSAPAAAYIESTVGVAAGGRTGLTAVVVGALFLAVMFVSPLA
GLVPSYATAPALMYVGLLMLSSVSRLHMDDMVDALAGLVCAVFIVLTCNIVTGIMLGFCT
LVVGRIVAGEWRKLNVGTVAIAVVLATFYAGGWAI