Protein Info for RS_RS03235 in Ralstonia solanacearum GMI1000

Annotation: DUF898 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 358 transmembrane" amino acids 34 to 55 (22 residues), see Phobius details amino acids 82 to 100 (19 residues), see Phobius details amino acids 106 to 124 (19 residues), see Phobius details amino acids 150 to 172 (23 residues), see Phobius details amino acids 208 to 231 (24 residues), see Phobius details amino acids 239 to 261 (23 residues), see Phobius details amino acids 288 to 309 (22 residues), see Phobius details PF05987: DUF898" amino acids 22 to 351 (330 residues), 414.7 bits, see alignment E=1.5e-128

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc0643)

Predicted SEED Role

"Thymidylate kinase (EC 2.7.4.9)" (EC 2.7.4.9)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.7.4.9

Use Curated BLAST to search for 2.7.4.9

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y1P7 at UniProt or InterPro

Protein Sequence (358 amino acids)

>RS_RS03235 DUF898 domain-containing protein (Ralstonia solanacearum GMI1000)
MNDIAREPVLGGAPAPAVPQPLRVRFCGSGSEYFRIWIVNLLLTIVTLGIYSAWAKVRTL
QYFYRNTQLGGASFDYHGSPTAILKGRAIIFVLALAFNLSGQVSPVLTLLLLAAIGLVFP
WLLVRSLRFRMANSSYRGLRFAFTGKDAQAYKVFLLWPVLTVFTFNLLAPFAHQRFKQYQ
HRNTRFGTTSFDFSATAGQFYGVYLRTFGMAILAVMAVGVVVVLAGVSAAAGAASGGRAI
AVSLMVLAMYAAMLFLGPYFLARLQNVVWNHTTLGAHRFQSQVSAGKLFWIFISNAALLI
VTLGLFTPFARVRSARYKLESVTMLAAGSLDTFVAGESTRVGALGDAAVDWYDIDIAL