Protein Info for RS_RS03205 in Ralstonia solanacearum GMI1000

Annotation: IS630 family transposase ISRso5

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 363 PF13384: HTH_23" amino acids 34 to 79 (46 residues), 39.6 bits, see alignment 9.8e-14 PF13518: HTH_28" amino acids 35 to 88 (54 residues), 40.5 bits, see alignment 6.8e-14 PF13551: HTH_29" amino acids 36 to 93 (58 residues), 35.3 bits, see alignment E=3e-12 PF13565: HTH_32" amino acids 62 to 133 (72 residues), 53 bits, see alignment E=1.2e-17 PF13358: DDE_3" amino acids 176 to 320 (145 residues), 67.3 bits, see alignment E=4.4e-22

Best Hits

KEGG orthology group: K07494, putative transposase (inferred from 100% identity to rso:RSc0110)

Predicted SEED Role

"Mobile element protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (363 amino acids)

>RS_RS03205 IS630 family transposase ISRso5 (Ralstonia solanacearum GMI1000)
MPMGRPKAELVLSEDEQTQLAGMVRSRSIPAALVMRARLVLAAAAGEPNSEIAERLQLTR
ATVGKWRARFLERRINGLYDELRPGKPRTIDDERVAELIKTTLHTKPADGSTHWSVRAVA
AETSISPTSVHRYFKLLGLQPHRSETFKLSTDAFFIEKLRDVVGLYLNPPENALVLCVDE
KSQCQALERTQPMLPMGLGYVEGVTHDYVRHGTTTLFAALNVLNGAVLAECKPRHRHQEF
LAFLRSIDKAVPADLDVHCIVDNYSSHKHPKVKAWLAARPRWHMHFIPTYSSWLNQVERF
FAIITDKAIRRGSFTSVKELVQKIDHFVAHYNQNCKPFAWTATADSILSKLSRLCERISG
TGH