Protein Info for RS_RS03135 in Ralstonia solanacearum GMI1000

Annotation: IMP dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 338 PF08240: ADH_N" amino acids 21 to 122 (102 residues), 95.8 bits, see alignment E=1.4e-31 PF00107: ADH_zinc_N" amino acids 173 to 279 (107 residues), 77.7 bits, see alignment E=7.9e-26

Best Hits

KEGG orthology group: K00100, [EC: 1.1.1.-] (inferred from 100% identity to rso:RSc0624)

Predicted SEED Role

"Threonine dehydrogenase and related Zn-dependent dehydrogenases" in subsystem Threonine degradation

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y1R5 at UniProt or InterPro

Protein Sequence (338 amino acids)

>RS_RS03135 IMP dehydrogenase (Ralstonia solanacearum GMI1000)
MYSAHDVRVENVPDATIVEPTDAIVRVTQACICGSDLWPYRAMEPSETGQSMGHEAIGVV
EAIGSGVNKIKVGDVVIMPFAYSDGRCEFCHEGLQTACVHGGFFGYGGFNGAQAEALRIP
QADGTLYALPGGVDSALMASLLTLSDVMGTGHHAARVARVRPGTSAAVIGDGAVGLCGVI
AAKRLGAERIILMGRHPDRIALAQAFGATDIVSERGEEAIERVRALTGGHGVHSVLECVG
TDQSMQTAANIARPGGAVGRVGVPHYNAIPADTTFFKNVIVGGGPAPVRAYIDDLLPDVL
DGKIQPGRVFDRVIGLDEVPDGYRAMDERQAIKVMINL