Protein Info for RS_RS02530 in Ralstonia solanacearum GMI1000

Annotation: 2-octaprenyl-6-methoxyphenyl hydroxylase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 411 PF01494: FAD_binding_3" amino acids 11 to 344 (334 residues), 54.2 bits, see alignment E=7.3e-19 TIGR01984: 2-polyprenyl-6-methoxyphenol 4-hydroxylase" amino acids 12 to 407 (396 residues), 468.2 bits, see alignment E=1.8e-144 TIGR01988: ubiquinone biosynthesis hydroxylase, UbiH/UbiF/VisC/COQ6 family" amino acids 12 to 406 (395 residues), 374.3 bits, see alignment E=6.2e-116

Best Hits

KEGG orthology group: K03185, 2-octaprenyl-6-methoxyphenol hydroxylase [EC: 1.14.13.-] (inferred from 100% identity to rso:RSc0508)

Predicted SEED Role

"2-octaprenyl-6-methoxyphenol hydroxylase (EC 1.14.13.-)" in subsystem Ubiquinone Biosynthesis (EC 1.14.13.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.14.13.-

Use Curated BLAST to search for 1.14.13.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y228 at UniProt or InterPro

Protein Sequence (411 amino acids)

>RS_RS02530 2-octaprenyl-6-methoxyphenyl hydroxylase (Ralstonia solanacearum GMI1000)
MTDTAAATPDFDIAIVGAGPVGLALANWLLRDTDWRIALFDARDAEAAARDPRALALSHG
SRVLLEAIGSWPARATPITHIHVSQRGHFGQTHIRREDYDIPALGHVVQYGDLSAALNAA
LATQVQRYPDRLARYDHTPVERVEQLPRADGSVAPARVRAAREGRHPLAVETAVVIQAEG
GLFDDARRQAARSSYLHHTRHRDYGQTAIVAHVRCAAPLEGWAWERFTTEGPLALLPQHD
ADGPGYALVWCCAPDQARRRAGLPDAAFLAELGAAFGERMGRFTQVGPRHTFALGLHARR
TPVDRRVVAIGNAAQTIHPVAGQGFNLGLRDAFELARALRDAVTPAALARFARERAFDRA
VTIGLTDLLPRAFAVPGRPVGHLRGIALTLLECVPPLKHELARQMMFGQRG