Protein Info for RS_RS01840 in Ralstonia solanacearum GMI1000

Annotation: RNA polymerase sigma factor RpoH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 306 TIGR02392: alternative sigma factor RpoH" amino acids 31 to 303 (273 residues), 408.8 bits, see alignment E=1.2e-126 PF00140: Sigma70_r1_2" amino acids 33 to 57 (25 residues), 29.8 bits, see alignment (E = 7.1e-11) TIGR02937: RNA polymerase sigma factor, sigma-70 family" amino acids 65 to 301 (237 residues), 110 bits, see alignment E=9.5e-36 PF04542: Sigma70_r2" amino acids 70 to 139 (70 residues), 74.1 bits, see alignment E=9.2e-25 PF04545: Sigma70_r4" amino acids 244 to 299 (56 residues), 53.5 bits, see alignment E=2e-18

Best Hits

Swiss-Prot: 55% identical to RPOH_VIBCH: RNA polymerase sigma factor RpoH (rpoH) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: K03089, RNA polymerase sigma-32 factor (inferred from 100% identity to rso:RSc0374)

Predicted SEED Role

"RNA polymerase sigma factor RpoH" in subsystem Heat shock dnaK gene cluster extended or Transcription initiation, bacterial sigma factors

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y2G2 at UniProt or InterPro

Protein Sequence (306 amino acids)

>RS_RS01840 RNA polymerase sigma factor RpoH (Ralstonia solanacearum GMI1000)
MNAVIPVNTVSAVATQPSSNAWALAFPGSLGNLDAYIQSVNRVPMLTAEEEQQLARDYHA
TGNLDAARRLVLSHLRLVVSIARQYLGYGLPHADLIQEGNVGLMKAVKRFDPDQGVRLVS
YAIHWIKAEMHEYILKNWRMVKVATTKAQRKLFFNLRSHKQDAHATFTSDEVDAVAQELN
VKGAEVREMETRLSGGDIALEGQIDDGEESFAPIAYLADTHNEPTRVLEGRGRDRLQSEG
IETALAKLDDRSRRIIEARWLHVNDDGSGGATLHELADEFGVSAERIRQIESAAMKKMKG
ALQSFA