Protein Info for RS_RS01585 in Ralstonia solanacearum GMI1000

Annotation: lipoyl synthase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 333 PF16881: LIAS_N" amino acids 42 to 85 (44 residues), 28 bits, see alignment 2.5e-10 TIGR00510: lipoyl synthase" amino acids 45 to 326 (282 residues), 427.8 bits, see alignment E=1.2e-132 PF04055: Radical_SAM" amino acids 100 to 263 (164 residues), 82.9 bits, see alignment E=3.2e-27

Best Hits

Swiss-Prot: 100% identical to LIPA_RALSO: Lipoyl synthase (lipA) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K03644, lipoic acid synthetase [EC: 2.8.1.8] (inferred from 100% identity to rso:RSc0322)

MetaCyc: 65% identical to lipoyl synthase (Escherichia coli K-12 substr. MG1655)
Lipoyl synthase. [EC: 2.8.1.8]

Predicted SEED Role

"Lipoate synthase" in subsystem Lipoic acid metabolism

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

No predicted isozymes

Use Curated BLAST to search for 2.8.1.8

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y2L3 at UniProt or InterPro

Protein Sequence (333 amino acids)

>RS_RS01585 lipoyl synthase (Ralstonia solanacearum GMI1000)
MTDSASGASAVANIATPSNEPYDATRKQKSLDKTARIPIKIVPAEKLKKPEWIRVKAATG
NSRFYEIKDILRANNLVTVCEEASCPNIGECFGKGTATFMIMGDKCTRRCPFCDVGHGRP
DPLDANEPENLAKTIAQLRLNYVVITSVDRDDLRDGGAQHYVDCISRTRELSPATRIEVL
VPDFRGRLEKALDILQACPPDVMNHNMETVPRLYKQARPGADYAHSLKLLKDFKARNPNL
PTKSGLMVGLGETDEEILEVMRDMREHDIDMLTIGQYLAPSGHHLPVLRYVHPDTFKMFE
EKAYEMGFTHAAVGAMVRSSYHADQQAHEAGFA