Protein Info for RS_RS01070 in Ralstonia solanacearum GMI1000

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 395 signal peptide" amino acids 1 to 32 (32 residues), see Phobius details transmembrane" amino acids 41 to 58 (18 residues), see Phobius details amino acids 67 to 86 (20 residues), see Phobius details amino acids 92 to 113 (22 residues), see Phobius details amino acids 125 to 148 (24 residues), see Phobius details amino acids 155 to 174 (20 residues), see Phobius details amino acids 204 to 223 (20 residues), see Phobius details amino acids 241 to 261 (21 residues), see Phobius details amino acids 270 to 293 (24 residues), see Phobius details amino acids 299 to 321 (23 residues), see Phobius details amino acids 332 to 354 (23 residues), see Phobius details amino acids 361 to 381 (21 residues), see Phobius details TIGR00710: drug resistance transporter, Bcr/CflA subfamily" amino acids 3 to 371 (369 residues), 299.9 bits, see alignment E=1.9e-93 PF07690: MFS_1" amino acids 5 to 347 (343 residues), 151.5 bits, see alignment E=2.9e-48 PF00083: Sugar_tr" amino acids 33 to 177 (145 residues), 26.3 bits, see alignment E=3.5e-10

Best Hits

KEGG orthology group: K07552, MFS transporter, DHA1 family, bicyclomycin/chloramphenicol resistance protein (inferred from 100% identity to rso:RSc0216)

Predicted SEED Role

"Bicyclomycin resistance protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y2W6 at UniProt or InterPro

Protein Sequence (395 amino acids)

>RS_RS01070 MFS transporter (Ralstonia solanacearum GMI1000)
MLAVLSLLMAFASISTDLYLPAMPAMQATLGASAGALEWTISGYLVGFSLGQLLWGPIGD
RTGRRLPIALGLLLFIGGSAGCALAASAPALIAWRAVQAAGACASVVLARAMVRDLYEGE
RAARMMSTLMTVMAIAPLVGPSAGGLILKLWSWRAIFWTLVIVGLATLAAVGTLPETLPA
HRRNDAPLHRTLARYGVLLRHPRLLGYLGVGGFFYGGMYAYVAGTPFAYIDYYHVPAQHY
GLLFGLGIVGIMATNLLNANLVGRFGGDRLMRAGAVAAALAGAAVALAARMGWGGLMGLV
IPLFVFVSTTGFIVANAMTGALGTFPQFAGSVSALVGATQYGTGILGSALVGALANGTPV
PMGLVIAACGSGGALAAVLLVPARRPMPVAPAAAG