Protein Info for RS_RS00895 in Ralstonia solanacearum GMI1000

Annotation: DUF4010 domain-containing protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 374 signal peptide" amino acids 1 to 23 (23 residues), see Phobius details transmembrane" amino acids 70 to 88 (19 residues), see Phobius details amino acids 100 to 118 (19 residues), see Phobius details amino acids 132 to 152 (21 residues), see Phobius details amino acids 161 to 182 (22 residues), see Phobius details amino acids 194 to 216 (23 residues), see Phobius details amino acids 223 to 243 (21 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 289 to 312 (24 residues), see Phobius details amino acids 324 to 343 (20 residues), see Phobius details amino acids 351 to 373 (23 residues), see Phobius details PF13194: DUF4010" amino acids 140 to 346 (207 residues), 161.1 bits, see alignment E=1.6e-51

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc0182)

Predicted SEED Role

"FIG00974989: hypothetical protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y2Z9 at UniProt or InterPro

Protein Sequence (374 amino acids)

>RS_RS00895 DUF4010 domain-containing protein (Ralstonia solanacearum GMI1000)
MRTFAIAGLAGAIAASLPISLAVPSVLLAVAMLAAVGYHHSADVDPGVTTEFALVATTLL
GAYAVSEPEMAAALGTVLLVLLYAKTALHRFARTVITQRELADLLTLAVAALLVWPAIPD
RSVGPLQAWNLHTLWLVVLLVMVTGNAGHLAARWLGDRIGLPLTGLFSGFASSVATIATM
AARVHAKHSPASGAAAAALLSNVATLVQMALLVAAIDIPLLRSLAAPIAVGLLVTVGWAV
FWMLRDKTPVRAEEENASSSINWRAAIGFGLWTAALLLVAAVSREWFGAAAVTAVALFGA
LADVHAATAAIATQAAGGTLARPMAGALVVLALSVNTLTKVVVATSGGKVFAGQVAAGLL
SALAASCAAFWIAA