Protein Info for RS_RS00770 in Ralstonia solanacearum GMI1000
Annotation: short chain dehydrogenase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
KEGG orthology group: K00540, [EC: 1.-.-.-] (inferred from 100% identity to rso:RSc0156)Predicted SEED Role
"FolM Alternative dihydrofolate reductase 1" in subsystem Folate Biosynthesis
MetaCyc Pathways
- superpathway of tetrahydrofolate biosynthesis and salvage (11/12 steps found)
- superpathway of tetrahydrofolate biosynthesis (9/10 steps found)
- folate transformations III (E. coli) (8/9 steps found)
- folate transformations II (plants) (9/11 steps found)
- dTMP de novo biosynthesis (mitochondrial) (3/3 steps found)
- tetrahydrofolate biosynthesis I (3/3 steps found)
- superpathway of chorismate metabolism (43/59 steps found)
KEGG Metabolic Maps
- Alkaloid biosynthesis I
- Carotenoid biosynthesis - General
- Insect hormone biosynthesis
- Nucleotide sugars metabolism
- Porphyrin and chlorophyll metabolism
- Puromycin biosynthesis
- Trinitrotoluene degradation
- alpha-Linolenic acid metabolism
Isozymes
Compare fitness of predicted isozymes for: 1.-.-.-
Use Curated BLAST to search for 1.-.-.-
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See Q8Y325 at UniProt or InterPro
Protein Sequence (267 amino acids)
>RS_RS00770 short chain dehydrogenase (Ralstonia solanacearum GMI1000) MAQTPNESPILPRIALVTGAARRVGRVIALALARQGWDVAVHCHRSRAEADAVAAEIIAM GRRAAVLQADLADEAAAGRLIADCTAALGTPTCLVNNASLFQYDVATSFSYASLDTHMRI NVAAPLLLARELHRVLAAEDGGAGEVRGVVVNLLDQKLDNLNPDFLSYTLSKAALATATT QLAQALAPTLRVVGVAPGATLVSWKQSESGFERAHKMAPLGRSSTPEDIAEAVCYLTTAR AVTGTTLFVDGGQHLMPLARDVMFLTE