Protein Info for RS_RS00590 in Ralstonia solanacearum GMI1000

Annotation: GNAT family N-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 164 transmembrane" amino acids 97 to 116 (20 residues), see Phobius details PF13302: Acetyltransf_3" amino acids 13 to 146 (134 residues), 31.7 bits, see alignment E=5.7e-11 PF13673: Acetyltransf_10" amino acids 40 to 150 (111 residues), 30.4 bits, see alignment E=8.9e-11 PF00583: Acetyltransf_1" amino acids 41 to 145 (105 residues), 46.6 bits, see alignment E=1e-15 PF13508: Acetyltransf_7" amino acids 66 to 146 (81 residues), 39.5 bits, see alignment E=1.5e-13 PF08445: FR47" amino acids 95 to 149 (55 residues), 26.6 bits, see alignment E=1.2e-09

Best Hits

KEGG orthology group: None (inferred from 100% identity to rso:RSc0120)

Predicted SEED Role

"Acetyltransferase, GNAT family (EC 2.3.1.-)" (EC 2.3.1.-)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.-

Use Curated BLAST to search for 2.3.1.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y361 at UniProt or InterPro

Protein Sequence (164 amino acids)

>RS_RS00590 GNAT family N-acetyltransferase (Ralstonia solanacearum GMI1000)
MPILPIDRPGAALRPVTPDDQPFLLGLYASTREAELRLTDWTDAQKQQFVRMQFEAQQRA
YFSYPEAAFFLILQDGAPAGRLYLQHRPDAILVIDVSLLPAFCGQGIGSAVLSAVFRLAA
DAGKRVQIHVERFNPAQRLYRRLGFRLVEDKGVYLFLEWGGAAA