Protein Info for RS_RS00135 in Ralstonia solanacearum GMI1000

Annotation: homoserine O-acetyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 403 TIGR01392: homoserine O-acetyltransferase" amino acids 45 to 393 (349 residues), 466 bits, see alignment E=3.9e-144 PF00561: Abhydrolase_1" amino acids 74 to 382 (309 residues), 83.9 bits, see alignment E=1.4e-27 PF00756: Esterase" amino acids 153 to 300 (148 residues), 23.9 bits, see alignment E=3.3e-09

Best Hits

Swiss-Prot: 100% identical to METXS_RALSO: Homoserine O-succinyltransferase (metXS) from Ralstonia solanacearum (strain GMI1000)

KEGG orthology group: K00641, homoserine O-acetyltransferase [EC: 2.3.1.31] (inferred from 100% identity to rso:RSc0027)

Predicted SEED Role

"Homoserine O-acetyltransferase (EC 2.3.1.31)" in subsystem Methionine Biosynthesis (EC 2.3.1.31)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 2.3.1.31

Use Curated BLAST to search for 2.3.1.31

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y3F3 at UniProt or InterPro

Protein Sequence (403 amino acids)

>RS_RS00135 homoserine O-acetyltransferase (Ralstonia solanacearum GMI1000)
MTELQVDPAASADPAAAADTPRHPAATLPPDSVGLVVPERMHFAEPLPLRNGSQLVGYDL
MVETYGTLNAERSNAVLICHALNASHHVAGVHAEGEVGWWDNMVGPGKPVDTNRFFVIGV
NNLGSCFGSTGPMSPHPQTGQPYGARFPVVTVEDWVNAQARVADRFGIRQFAAVMGGSLG
GMQALAWSLMYPERVRHCVVVASTPKLSAQNIAFNEVARSAILSDPDFHGGDYYAHNVKP
KRGLRVARMIGHITYLSDEDMAEKFGRELKAEDIRFSFDVEFQVESYLRYQGDKFAEYFD
ANTYLLITRALDYFDPALAYEGSLTRAVAHTRASYLVVSFTTDWRFAPARSRELVKALLD
NKRPVTYGEIDAPHGHDAFLLEDARYHALVRAYYERIAQEIGA