Protein Info for RS_RS00105 in Ralstonia solanacearum GMI1000

Annotation: sensor histidine kinase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 487 signal peptide" amino acids 1 to 35 (35 residues), see Phobius details transmembrane" amino acids 202 to 225 (24 residues), see Phobius details PF17200: sCache_2" amino acids 47 to 190 (144 residues), 116.5 bits, see alignment E=2.6e-37 PF08269: dCache_2" amino acids 75 to 184 (110 residues), 103.8 bits, see alignment E=2.6e-33 PF17201: Cache_3-Cache_2" amino acids 76 to 191 (116 residues), 45.8 bits, see alignment E=1.3e-15 PF07730: HisKA_3" amino acids 249 to 326 (78 residues), 50.4 bits, see alignment E=6.9e-17 PF02518: HATPase_c" amino acids 374 to 463 (90 residues), 43.7 bits, see alignment E=8.4e-15

Best Hits

KEGG orthology group: K02480, two-component system, NarL family, sensor kinase [EC: 2.7.13.3] (inferred from 100% identity to rso:RSc0021)

Predicted SEED Role

"Sensor histidine kinase"

Isozymes

Compare fitness of predicted isozymes for: 2.7.13.3

Use Curated BLAST to search for 2.7.13.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See Q8Y3F9 at UniProt or InterPro

Protein Sequence (487 amino acids)

>RS_RS00105 sensor histidine kinase (Ralstonia solanacearum GMI1000)
MKLRQKILLLAVAPLTIAMLAIMLTVRHQSIALAQHERQLVESAYLQAKEAELRAHVKLA
RSAIAPLLASGRSDQATRDEAMRTLARLDFGPDGYFFLYDLRGRNLMHPRQPELVGRDLW
RLTDARGQPTIQRLVAAAQAGGGFVRYLWDKPSSHQSVAKLGYVEPIPQWGWMVGTGLYL
DDVEQTLREIDRRAQANIDQTLAWVVAIAAVCILLVAGSGLALNVSDHREADAKLRQLAQ
QVVHSQEDERARVSRELHDGISQVLVSTKLLLETAHGHLEPPPGHATPPGAPATDKAAGM
LRRALDRLNGALGEVRRVSHNLRPALLDDLGLAAALELLVRETREAHEDRQPGFAITLET
AGPPVQLPDACNTAFFRIAQEAVSNIERHATGATRIGLLLENDLDAVRLSIRDNGPGFDV
ESVQVDPEHGIGLRNMRERMAALGGTCTIVSGPHGTEVGVALPHLVIARLASAAASSSAS
VSASPSA