Protein Info for RR42_RS37470 in Cupriavidus basilensis FW507-4G11

Annotation: permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 256 transmembrane" amino acids 14 to 42 (29 residues), see Phobius details amino acids 46 to 72 (27 residues), see Phobius details amino acids 83 to 102 (20 residues), see Phobius details amino acids 108 to 126 (19 residues), see Phobius details amino acids 138 to 163 (26 residues), see Phobius details amino acids 180 to 220 (41 residues), see Phobius details amino acids 232 to 253 (22 residues), see Phobius details PF01925: TauE" amino acids 21 to 246 (226 residues), 103.4 bits, see alignment E=8.1e-34

Best Hits

KEGG orthology group: K07090, (no description) (inferred from 73% identity to rme:Rmet_1940)

Predicted SEED Role

"putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YPU8 at UniProt or InterPro

Protein Sequence (256 amino acids)

>RR42_RS37470 permease (Cupriavidus basilensis FW507-4G11)
MPVDLTALLPDVSLPAYLAMCLAIAGAYVIFGMAGFGTALVAGPLLAYLMPVSQIVALLA
LMDCTAAAFALLRDGRAADRAELGRLLPCMLAGSLVGAALLLKLQSDLLPLLLGVFAMGY
AIWSFAGKRPSGFTPRAALPFGLGGGLCSAMFGSGGFLYAIYLSGRLGKDAMRMTQSTLI
GVSTLTRLVLFALAGVYAGAAIIKLALLLAPAMALGLWAGRRITLRLSREQFLRMVNAVV
LCSGGALVLHYLLRLD