Protein Info for RR42_RS37460 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 417 transmembrane" amino acids 24 to 47 (24 residues), see Phobius details amino acids 53 to 73 (21 residues), see Phobius details amino acids 85 to 108 (24 residues), see Phobius details amino acids 115 to 137 (23 residues), see Phobius details amino acids 149 to 172 (24 residues), see Phobius details amino acids 178 to 197 (20 residues), see Phobius details amino acids 227 to 252 (26 residues), see Phobius details amino acids 263 to 282 (20 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 320 to 337 (18 residues), see Phobius details amino acids 375 to 400 (26 residues), see Phobius details PF05977: MFS_3" amino acids 16 to 400 (385 residues), 132.6 bits, see alignment E=1.6e-42 PF07690: MFS_1" amino acids 25 to 361 (337 residues), 97.2 bits, see alignment E=9.8e-32

Best Hits

KEGG orthology group: None (inferred from 85% identity to reu:Reut_B5333)

Predicted SEED Role

"MFS permease"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YRF2 at UniProt or InterPro

Protein Sequence (417 amino acids)

>RR42_RS37460 MFS transporter (Cupriavidus basilensis FW507-4G11)
MSTPASVPAPEPDSVFRDPSFRLFWFARLCTTIGYQIFTVAVGWQIYDLTRDPFMLGMVG
LVQFLPSVMLLLMSGHVADRFDRRLIVRTCQTLEALIAVSMAVASLSGSITRDHIFVFVA
LIGATRAFETPTLQALLPSVVTPRMFPRAVALSSSATQTAIIIGPALGGFAYVAGPGVVY
AISATLFAVAACLVTALKLRQAAQRLTTPVSIATLFAGFSYIRGRPVLLGAISLDLFAVL
LGGATALLPIYARDILHTGPWGLGLLRSSPAIGALATALWLAHHPMNRRVGRVMFGAVAV
FGMATMVFGISHWLPLSMAALVMLGASDMISVVVRSTLVQLDTPDDMRGRVGAVNSVFIG
ASNQLGEFESGVTAALFGPVGAVLLGGIGTLVVVVVWMRLFPSLASRDRLHDHPVTA