Protein Info for RR42_RS37060 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 transmembrane" amino acids 23 to 45 (23 residues), see Phobius details amino acids 160 to 182 (23 residues), see Phobius details amino acids 191 to 210 (20 residues), see Phobius details PF03929: PepSY_TM" amino acids 10 to 179 (170 residues), 35.8 bits, see alignment E=8.2e-13 PF16357: PepSY_TM_like_2" amino acids 15 to 211 (197 residues), 286.8 bits, see alignment E=1.1e-89

Best Hits

KEGG orthology group: K09939, hypothetical protein (inferred from 78% identity to reu:Reut_B5215)

Predicted SEED Role

"FIG019175: putative membrane protein"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YSS9 at UniProt or InterPro

Protein Sequence (211 amino acids)

>RR42_RS37060 membrane protein (Cupriavidus basilensis FW507-4G11)
MTETSLGAGQQRRAFWLKHLHQWHWISSAMCLIGMLLFAVTGFTLNHAGQIEARAQVVTR
TASAPASLTAALRRATHADKGPVPTALADWLSQELDINAHGREAEWQANEIYVALPRPGG
DAWVSVALDSGEVQYEKTTRGWISYLNDLHKGRNTGRAWSLFLDVFAAACLIFSVTGLFL
LKLHAGGRMATWPLVGLGLVVPLLLALLFIH