Protein Info for RR42_RS37040 in Cupriavidus basilensis FW507-4G11

Annotation: sulfite reductase subunit alpha

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 527 signal peptide" amino acids 1 to 29 (29 residues), see Phobius details PF00258: Flavodoxin_1" amino acids 64 to 190 (127 residues), 82.8 bits, see alignment E=2.9e-27 PF00175: NAD_binding_1" amino acids 396 to 500 (105 residues), 26.8 bits, see alignment E=6.9e-10

Best Hits

KEGG orthology group: K00380, sulfite reductase (NADPH) flavoprotein alpha-component [EC: 1.8.1.2] (inferred from 72% identity to reh:H16_B2500)

Predicted SEED Role

"probable oxidoreductase"

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.2

Use Curated BLAST to search for 1.8.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YR82 at UniProt or InterPro

Protein Sequence (527 amino acids)

>RR42_RS37040 sulfite reductase subunit alpha (Cupriavidus basilensis FW507-4G11)
MILLGALAGVAGIALGLLAPSRAGMAAGVVIAYAGFCAAVIGRHRQRHARAGQLSEARDG
ATVVAYASQSGFAEQLALQTAQALQDAGVPAQLLSFDQLEAGRLAHCRQALFVVSTTGEG
DAPDSASGFARRLTAAAGAGGLGELRYGILALGDRSYANYCAFGHALSAWMQRQHAQALF
DMVEVDNGDAGALRHWQNHLSALCGGAEIADWEKPRYADWRLHERRLLNPGSPGAPAFHL
ALVPAAVGQGAPSWQAGDIAEIGPRLAPSEVARVLAKLSLDGDTAVRCDGASTTLAQALA
TRIVLPDPHLAALDGVTPQRLVDTLPPLPHREYSIASLPGDGQLDLLVRQTRHDDGRLGL
ASGWLTAHAQPGAGIALRIRTNRGFHPPADDRPLILIGNGTGLAGLRAHLKARAVAGHHR
NWLLFGERTAEHDAFHHVELAAWQANGVLQRLDLVYSRDGGPLRYVQDAVRASAGALREW
IEAGAAIYVCGSLKGMAGGVNAALADVLGEEALLRLGEQGRYRRDVY