Protein Info for RR42_RS36765 in Cupriavidus basilensis FW507-4G11

Annotation: cbb3-type cytochrome C oxidase subunit III

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13442: Cytochrome_CBB3
  • amino acids 68 to 153 (86 residues), 54.1 bits, E=1.6e-18
• PF00034: Cytochrom_C
  • amino acids 69 to 157 (89 residues), 53.4 bits, E=5.6e-18

Best Hits

KEGG orthology group: None (inferred from 54% identity to put:PT7_1822)

Predicted SEED Role

"Cytochrome c oxidase subunit CcoO (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• arsenite to oxygen electron transfer (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• arsenite to oxygen electron transfer (via azurin) (2/3 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

See A0A0C4YSL2 at UniProt or InterPro

Protein Sequence (201 amino acids)

>RR42_RS36765 cbb3-type cytochrome C oxidase subunit III (Cupriavidus basilensis FW507-4G11)
MKPSQAHKTENADSVEQHNPVPKIVLALVCGLLVWAISYILIERADGSAALGDRRDLAAL
AAPAGQGRVADGKLLFAANCQACHQASGQGIPGVFPPLAGSPWVNDDPDRLAQILLHGMT
GPLEVLGTTYNGAMPAFGEQFSDQEIAALATHIRSQWGNGAAPVEAARIAAARAASVAQK
APWHGGEALQAFTTTGGAPKP