Protein Info for RR42_RS36595 in Cupriavidus basilensis FW507-4G11

Annotation: acyl-CoA dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 389 PF02771: Acyl-CoA_dh_N" amino acids 14 to 118 (105 residues), 88.9 bits, see alignment E=6.2e-29 PF02770: Acyl-CoA_dh_M" amino acids 123 to 221 (99 residues), 76.1 bits, see alignment E=4e-25 PF00441: Acyl-CoA_dh_1" amino acids 234 to 367 (134 residues), 110.7 bits, see alignment E=1.4e-35 PF08028: Acyl-CoA_dh_2" amino acids 251 to 362 (112 residues), 49.4 bits, see alignment E=1.2e-16

Best Hits

KEGG orthology group: K00249, acyl-CoA dehydrogenase [EC: 1.3.99.3] (inferred from 93% identity to reu:Reut_B3542)

Predicted SEED Role

"Probable acyl-CoA dehydrogenase (EC 1.3.99.3)" in subsystem Isoleucine degradation or Valine degradation (EC 1.3.99.3)

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.3.99.3

Use Curated BLAST to search for 1.3.99.3

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YWL0 at UniProt or InterPro

Protein Sequence (389 amino acids)

>RR42_RS36595 acyl-CoA dehydrogenase (Cupriavidus basilensis FW507-4G11)
MFADQSHDQPYPDIREAVRALCTGFDSAYWQRVEEQNAFPEEFVQALTKAGWLSALIPEE
YGGSGLPLTAASVIMEEINRTGGNSGACHGQMYVMGCLLRHGSAEQKQRWLPGIASGELR
MQSMAVTEPTTGTDTTKLKTTAVKKGDRYVINGQKVWISRVQHSDLMLLLARTTPLDQVK
RKSEGLSVFVVDLREAIGKGLTVRPIRNMVNHETNELFFDNLEIPAENLIGEEGKGLKYI
LDGLNAERILIASECVGDGYWFIERASSYARERIVFDRPIGQNQGIQFPIARAYVNVEAA
SLMRYKAAALFDAGKPCGKEANISKLLAADASWEAANVCLQTHGGFGFAAEYDIERKFRE
TRLYQVAPISTNLILSYVAEHVLELPRSF