Protein Info for RR42_RS36375 in Cupriavidus basilensis FW507-4G11

Annotation: aspartate:proton symporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 524 transmembrane" amino acids 12 to 34 (23 residues), see Phobius details amino acids 46 to 67 (22 residues), see Phobius details amino acids 88 to 112 (25 residues), see Phobius details amino acids 134 to 152 (19 residues), see Phobius details amino acids 163 to 182 (20 residues), see Phobius details amino acids 200 to 223 (24 residues), see Phobius details amino acids 235 to 257 (23 residues), see Phobius details amino acids 282 to 301 (20 residues), see Phobius details amino acids 340 to 359 (20 residues), see Phobius details amino acids 365 to 387 (23 residues), see Phobius details amino acids 400 to 420 (21 residues), see Phobius details amino acids 426 to 443 (18 residues), see Phobius details amino acids 463 to 486 (24 residues), see Phobius details amino acids 493 to 515 (23 residues), see Phobius details PF03845: Spore_permease" amino acids 12 to 254 (243 residues), 28 bits, see alignment E=1.5e-10 PF13520: AA_permease_2" amino acids 12 to 420 (409 residues), 149.4 bits, see alignment E=2.3e-47 PF00324: AA_permease" amino acids 17 to 385 (369 residues), 90.6 bits, see alignment E=1.5e-29

Best Hits

Swiss-Prot: 60% identical to ASPP_BACSU: Aspartate-proton symporter (yveA) from Bacillus subtilis (strain 168)

KEGG orthology group: None (inferred from 81% identity to pfl:PFL_1414)

Predicted SEED Role

"Aspartate-proton symporter"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YG64 at UniProt or InterPro

Protein Sequence (524 amino acids)

>RR42_RS36375 aspartate:proton symporter (Cupriavidus basilensis FW507-4G11)
MSPVQGKFKRQLSLTDLTFIGLGAIFGSGWLFAASHVSAIAGPAGIISWLLGGFAVLLLG
IVYCELGAALPRAGGIIRYPVFSHGELMGYLMGLITLIAFSSLIAIEVVAARQYAAAWFP
FLSQPGSSNPTLPGWALQFAMLCLFFVLNYYSVKTFARANNIVSVFKFVVPLLVIVVLFT
HFKPANLQVHGFAPFGLSGIQAAVSAGGIIFAYLGLTPIISVASEVRSPQRTIPIALILS
VLLSTLIYVLLQIAFLGGVPTETLSDGWRGVGQAFALPYRDIALALGVGWLAFLVVSDAV
ISPSGTGNIYMNATPRVVYGWARGGTFFKSFSRIDAASGIPRPALWLTFALSVFWTLPFP
SWEAMINVVSAALVLSYAVAPVTVAALRRNAPSLHRPFRVRWLAVLGPLSFIIAALIVYW
SGWGTVSWLLGLQIAMFVVYLLCRRAVPTHRLSLAQQVKSSLWLIAFYLLIIVASYLGTF
GGIGAISHPWDTGLVALIALGIYGWGARTGIPAALLDLGGDDDE