Protein Info for RR42_RS36245 in Cupriavidus basilensis FW507-4G11

Annotation: excisionase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF12728: HTH_17
  • amino acids 4 to 52 (49 residues), 34.3 bits, 3.3e-12
• PF13411: MerR_1
  • amino acids 6 to 52 (47 residues), 25.5 bits, 1.7e-09
• PF00285: Citrate_synt
  • amino acids 71 to 383 (313 residues), 188.6 bits, E=2.8e-59

Best Hits

KEGG orthology group: K01647, citrate synthase [EC: 2.3.3.1] (inferred from 70% identity to dac:Daci_4908)

Predicted SEED Role

"Citrate synthase (si) (EC 2.3.3.1)" in subsystem Serine-glyoxylate cycle or TCA Cycle (EC 2.3.3.1)

MetaCyc Pathways

• superpathway of glycolysis, pyruvate dehydrogenase, TCA, and glyoxylate bypass (23/26 steps found)
• superpathway of cytosolic glycolysis (plants), pyruvate dehydrogenase and TCA cycle (19/22 steps found)
• TCA cycle III (animals) (10/10 steps found)
• TCA cycle II (plants and fungi) (9/9 steps found)
• superpathway of glyoxylate bypass and TCA (11/12 steps found)
• TCA cycle I (prokaryotic) (9/10 steps found)
• glyoxylate cycle (6/6 steps found)
• TCA cycle V (2-oxoglutarate synthase) (8/9 steps found)
• nitrogen remobilization from senescing leaves (7/8 steps found)
• partial TCA cycle (obligate autotrophs) (7/8 steps found)
• superpathway of glyoxylate cycle and fatty acid degradation (11/14 steps found)
• TCA cycle IV (2-oxoglutarate decarboxylase) (7/9 steps found)
• mixed acid fermentation (12/16 steps found)
• methylaspartate cycle (14/19 steps found)
• TCA cycle VI (Helicobacter) (6/9 steps found)
• TCA cycle VII (acetate-producers) (6/9 steps found)
• ethene biosynthesis V (engineered) (17/25 steps found)

KEGG Metabolic Maps

• Biosynthesis of alkaloids derived from histidine and purine
• Biosynthesis of alkaloids derived from ornithine, lysine and nicotinic acid
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of alkaloids derived from terpenoid and polyketide
• Biosynthesis of phenylpropanoids
• Biosynthesis of plant hormones
• Biosynthesis of terpenoids and steroids
• Citrate cycle (TCA cycle)
• Glyoxylate and dicarboxylate metabolism

Isozymes

Compare fitness of predicted isozymes for: 2.3.3.1

Use Curated BLAST to search for 2.3.3.1

Sequence Analysis Tools

See A0A0C4YQR9 at UniProt or InterPro

Protein Sequence (392 amino acids)

>RR42_RS36245 excisionase (Cupriavidus basilensis FW507-4G11)
MPRYLTSSEAAAQLGVSRQTLYAYVSRGLLHAHDGETHRESRYLADDVARLAGQRTRGRK
PREVAKATLSWGLPVLESGITLIEDGRLYYRGMDAVALAASDTVEAVAALLWQCPQDAAF
GAAPLAPAHLAAMQAAFSGRRSEEALLPLFTIASEDDPTAQWQRSPERLAEGCGALVRLL
AACLLHTAPASAPVHRQCASAWQVDEEGADLIRMALVLCADHELNASSFTSRCVASTGAS
LRASVVAGLAALTGGLHGGTTARVEALWDELGEAQPASKLRERLARGENLPGFGHHLYPA
GDIRAAGLLARILPHHPQWQAFIDDAFALVGQRPSIDFALVALRRHLRLPPGAAFGMFAL
GRSIGWIAHALEQRADAELIRPRAAYVGPRPG