Protein Info for RR42_RS36210 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 446 transmembrane" amino acids 16 to 41 (26 residues), see Phobius details amino acids 50 to 72 (23 residues), see Phobius details amino acids 81 to 100 (20 residues), see Phobius details amino acids 106 to 128 (23 residues), see Phobius details amino acids 144 to 165 (22 residues), see Phobius details amino acids 171 to 189 (19 residues), see Phobius details amino acids 229 to 251 (23 residues), see Phobius details amino acids 270 to 289 (20 residues), see Phobius details amino acids 299 to 317 (19 residues), see Phobius details amino acids 324 to 346 (23 residues), see Phobius details amino acids 359 to 381 (23 residues), see Phobius details amino acids 387 to 409 (23 residues), see Phobius details PF07690: MFS_1" amino acids 20 to 374 (355 residues), 150.8 bits, see alignment E=7.3e-48 PF12832: MFS_1_like" amino acids 31 to 156 (126 residues), 26.9 bits, see alignment E=3.9e-10 PF00083: Sugar_tr" amino acids 42 to 417 (376 residues), 92.1 bits, see alignment E=5.8e-30

Best Hits

KEGG orthology group: None (inferred from 86% identity to reu:Reut_B3769)

Predicted SEED Role

"Sialic acid transporter (permease) NanT" in subsystem Sialic Acid Metabolism

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YP47 at UniProt or InterPro

Protein Sequence (446 amino acids)

>RR42_RS36210 MFS transporter (Cupriavidus basilensis FW507-4G11)
MFTWFKDLSTMERKGFYGAFLGHAVDVFDFMIYSFLISTLLTQWGMSKSAAGAIVTWTLV
SSLVGAIGAGVLADRYGRVRVLRWTIVVFAVACFLCGLANTPEQLLAFRMLQGLGFGGES
SLCMVLVTEMIRNPAHRGKYSGFTASSYSFGWGAAAVAYAITFSIFPAETAWRVCFFMGI
LPALVVIYLRRNLEEPEVFTKSQAERAAAGAGSGPTAWQQLARLGRRPLLGKTVLCSLLS
GGMLGAYYAIATWLPTFLKTERGLSVFGTSSYLAMTIAGSLVGYVAGAYATDRWGRRQTY
IAFAAGAFVMALVYMVIPVSNTSMLFLGFPLGVLMQGVFAGIGATISESYPNDIRATGYG
VSYNVGRVIGSLFPLTVGWLSTGRTSLPLAIAIVAGVGYMMVMGAALLLPETKGMDLGQA
GGDDSAHEPSGDADKTVLAPTVGKPA