Protein Info for RR42_RS36125 in Cupriavidus basilensis FW507-4G11
Annotation: IclR family transcriptional regulator
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 43% identical to PCAR_PSEPU: Pca regulon regulatory protein (pcaR) from Pseudomonas putida
KEGG orthology group: K02624, IclR family transcriptional regulator, pca regulon regulatory protein (inferred from 82% identity to reh:H16_B0167)Predicted SEED Role
"Transcriptional regulator, IclR family" in subsystem Homogentisate pathway of aromatic compound degradation
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Compare to protein structures
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4YS80 at UniProt or InterPro
Protein Sequence (282 amino acids)
>RR42_RS36125 IclR family transcriptional regulator (Cupriavidus basilensis FW507-4G11) MASPAAPDNSDHPATDAPVAPAAAPGPDKPSDTYVQSFARGLSVIRAFDAQHPAQTLSEI AQASGLTRAGARRILLTLVGLGYVRADGRLFRLTPKILDLGFAYLTSMPFWNLAEPIMEA LSQEVRESCSISVLDGTEIVYVLRVPARKIMTINLSIGSRLPAYCSSMGRVLLAGLPLEE LDRVLGASELRARTSRTVTDPAELKAIIAGIRTRGWAQNDQELEEGLVSLAAPIRNRAGQ VIAAINISGQANRTSADDMASSFLPALLAASEKISNLISLRS