Protein Info for RR42_RS35875 in Cupriavidus basilensis FW507-4G11

Annotation: UDP-galactose-4-epimerase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF04321: RmlD_sub_bind
  • amino acids 4 to 165 (162 residues), 38 bits, E=3.6e-13
• TIGR01179: UDP-glucose 4-epimerase GalE
  • amino acids 5 to 334 (330 residues), 430.4 bits, E=1.9e-133
• PF01370: Epimerase
  • amino acids 6 to 263 (258 residues), 175.3 bits, E=5.2e-55
• PF16363: GDP_Man_Dehyd
  • amino acids 6 to 325 (320 residues), 177.4 bits, E=2e-55
• PF02719: Polysacc_synt_2
  • amino acids 6 to 184 (179 residues), 38.3 bits, E=3.2e-13
• PF01073: 3Beta_HSD
  • amino acids 7 to 161 (155 residues), 37.6 bits, E=4.8e-13
• PF07993: NAD_binding_4
  • amino acids 7 to 164 (158 residues), 20.6 bits, E=7.8e-08
• PF13460: NAD_binding_10
  • amino acids 9 to 167 (159 residues), 31 bits, E=8.3e-11

Best Hits

Swiss-Prot: 58% identical to GALE_BIFL2: UDP-glucose 4-epimerase (lnpD) from Bifidobacterium longum subsp. longum (strain ATCC 15707 / DSM 20219 / JCM 1217 / NCTC 11818 / E194b)

KEGG orthology group: K01784, UDP-glucose 4-epimerase [EC: 5.1.3.2] (inferred from 86% identity to cti:RALTA_B0236)

MetaCyc: 56% identical to UDP-galactose 4-epimerase (Homo sapiens)
UDP-N-acetylglucosamine 4-epimerase. [EC: 5.1.3.7]; UDP-glucose 4-epimerase. [EC: 5.1.3.7, 5.1.3.2]

Predicted SEED Role

"UDP-glucose 4-epimerase (EC 5.1.3.2)" in subsystem Lacto-N-Biose I and Galacto-N-Biose Metabolic Pathway or Lactose and Galactose Uptake and Utilization or N-linked Glycosylation in Bacteria or Rhamnose containing glycans or linker unit-arabinogalactan synthesis (EC 5.1.3.2)

MetaCyc Pathways

• colanic acid building blocks biosynthesis (11/11 steps found)
• UDP-α-D-galactose biosynthesis (1/1 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis I (1/1 steps found)
• superpathway of UDP-glucose-derived O-antigen building blocks biosynthesis (4/6 steps found)
• UDP-α-D-galactofuranose biosynthesis (1/2 steps found)
• UDP-N-acetyl-D-galactosamine biosynthesis II (4/7 steps found)
• D-galactose detoxification (1/3 steps found)
• D-galactose degradation I (Leloir pathway) (2/5 steps found)
• stachyose degradation (2/7 steps found)
• UDP-sugars interconversion (3/9 steps found)
• teichuronic acid biosynthesis (B. subtilis 168) (2/9 steps found)
• superpathway of mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (12/33 steps found)
• mycolyl-arabinogalactan-peptidoglycan complex biosynthesis (1/18 steps found)

KEGG Metabolic Maps

• Aminosugars metabolism
• Galactose metabolism
• Nucleotide sugars metabolism

Isozymes

Compare fitness of predicted isozymes for: 5.1.3.2

Use Curated BLAST to search for 5.1.3.2 or 5.1.3.7

Sequence Analysis Tools

See A0A0C4YQK3 at UniProt or InterPro

Protein Sequence (339 amino acids)

>RR42_RS35875 UDP-galactose-4-epimerase (Cupriavidus basilensis FW507-4G11)
MSETLLLTGATGYIASHTWVALLEAGYHVIGLDNLCNSNRAVVERLAQITGQRPHFVEGD
VRDRALLDRLFAEHRISGAIHFAALKAVGESVSKPLDYYDNNLNGLLTLCSVMNTAGVKQ
LVFSSSATVYGNPHTVPILEDFPLSATNPYGQTKLMSEQILRDLELSDPAWRIAYLRYFN
PVGAHESGLIGEDPGGVPNNLMPYVAQVAGGRREKLQVHGGDYPTVDGTGVRDYIHVCDL
AAGHLAALVYLRDQQQCLTVNLGTGRGYSVLEVVAAYQRASGRPVPYVIGDRRPGDIASC
YADPALAQKLIGWRAQHDIDRMCEDSWRWQSMNPLGFAG