Protein Info for RR42_RS35840 in Cupriavidus basilensis FW507-4G11

Annotation: chemotaxis protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 546 transmembrane" amino acids 169 to 196 (28 residues), see Phobius details amino acids 202 to 223 (22 residues), see Phobius details PF13426: PAS_9" amino acids 20 to 106 (87 residues), 41.6 bits, see alignment E=3.3e-14 TIGR00229: PAS domain S-box protein" amino acids 23 to 114 (92 residues), 43.8 bits, see alignment E=1.3e-15 PF00989: PAS" amino acids 24 to 107 (84 residues), 35.5 bits, see alignment E=2.2e-12 PF08447: PAS_3" amino acids 31 to 113 (83 residues), 49.2 bits, see alignment E=1.4e-16 PF00672: HAMP" amino acids 221 to 270 (50 residues), 37.3 bits, see alignment 7.2e-13 PF00015: MCPsignal" amino acids 335 to 491 (157 residues), 187.9 bits, see alignment E=3.7e-59

Best Hits

KEGG orthology group: K03776, aerotaxis receptor (inferred from 81% identity to reu:Reut_B5601)

Predicted SEED Role

"Aerotaxis sensor receptor protein" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YNY2 at UniProt or InterPro

Protein Sequence (546 amino acids)

>RR42_RS35840 chemotaxis protein (Cupriavidus basilensis FW507-4G11)
MRNNQPVTSREYKLRADDYLISRTDLKGRITFANRAFIEASGFEPEELLGAAHNLVRHPD
MPPEAFVDLWKTIQAGRSWVGIVKNRRKDGDFYWVSATVTPTIVDGQLVGYTSVRSMPQR
EQVEAAGAAYARLREGSGSGLAVRDGAVVRRGLAGLPARLGKITLKRRILLSQAAGLVWF
LAALLAFEALAGAQAISQLRPWLWGGFGLAVASSFIGGTLLLARVNRPVQDMLDFALRMG
AGDLTTRLDYRASDEVGALARAMRTMQRSLLSVVAEIQEGMTSISTATRQVAAGNSDLSQ
RTEQQAASLEETASSMEELTSTVRQNADNARQASGLAANASEIAVKGGEVVGRVVQTMDD
INGASKKIVDIIGVIEGIAFQTNILALNAAVEAARAGEQGRGFAVVAGEVRGLAQRSANA
AKEIKGLIGDTVARVDNGSALVGQAGLTMGEIVQAVKRVTDIMGEISAASAEQSSGIEQV
NKAVAQMDEVTQQNAALVEQAAAAAGALEDQAGRLRDAVATFRVSLRPEARPVRARQGDA
PHLAQA