Protein Info for RR42_RS35800 in Cupriavidus basilensis FW507-4G11
Annotation: chemotaxis protein CheW
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 69% identical to CHEW_KLEAK: Chemotaxis protein CheW (cheW) from Klebsiella aerogenes (strain ATCC 13048 / DSM 30053 / JCM 1235 / KCTC 2190 / NBRC 13534 / NCIMB 10102 / NCTC 10006)
KEGG orthology group: K03408, purine-binding chemotaxis protein CheW (inferred from 90% identity to reh:H16_B0240)Predicted SEED Role
"Positive regulator of CheA protein activity (CheW)" in subsystem Bacterial Chemotaxis or Two-component regulatory systems in Campylobacter
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4YQI9 at UniProt or InterPro
Protein Sequence (164 amino acids)
>RR42_RS35800 chemotaxis protein CheW (Cupriavidus basilensis FW507-4G11) MAGIGHIDTPGSEASGQEFLVFTLGSEEYGIDILKVQEIRGYDAVTRLANAPDFIKGVTN LRGVIVPIVDLRLKFRLGNVRYDHHTVVIILNIAGRVVGIVVDGVSDVLTLTGEAIKPAP EFGVSVSNDHLTGLGTVDGRMLILIDIEKLMTSAEMELVEAELA