Protein Info for RR42_RS35775 in Cupriavidus basilensis FW507-4G11

Annotation: chemotaxis protein CheZ

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 211 PF04344: CheZ" amino acids 14 to 211 (198 residues), 263.9 bits, see alignment E=5.6e-83

Best Hits

Swiss-Prot: 64% identical to CHEZ_BORPE: Protein phosphatase CheZ (cheZ) from Bordetella pertussis (strain Tohama I / ATCC BAA-589 / NCTC 13251)

KEGG orthology group: K03414, chemotaxis protein CheZ (inferred from 85% identity to rme:Rmet_3695)

Predicted SEED Role

"Chemotaxis response - phosphatase CheZ" in subsystem Bacterial Chemotaxis

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YQI5 at UniProt or InterPro

Protein Sequence (211 amino acids)

>RR42_RS35775 chemotaxis protein CheZ (Cupriavidus basilensis FW507-4G11)
MSTTPTLSNESAEQLFQRIGALTRMLRDNMRELGLDKEIERAAQAIPDARDRLSYIASMT
EQAAERTLTAVELAQPIQSGMEKQAEALDKRWEAWFETPVELGDARELVLDTRAFLTDVP
QQARATGSHLLDIMMAQDFQDLTGQVIKKMMDMIHSLEQELLQVLIDNVPADRRVEAPAT
LMNGPQVNPEGKADVVSDQSQVDDLLASLGF