Protein Info for RR42_RS35465 in Cupriavidus basilensis FW507-4G11

Annotation: cytochrome C

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 260 PF21342: SoxA-TsdA_cyt-c" amino acids 55 to 134 (80 residues), 46 bits, see alignment E=6.2e-16 PF00034: Cytochrom_C" amino acids 157 to 234 (78 residues), 31.9 bits, see alignment E=4.2e-11 PF13442: Cytochrome_CBB3" amino acids 157 to 234 (78 residues), 37 bits, see alignment E=5.2e-13

Best Hits

Swiss-Prot: 48% identical to TSDA_ALLVD: Thiosulfate dehydrogenase (tsdA) from Allochromatium vinosum (strain ATCC 17899 / DSM 180 / NBRC 103801 / NCIMB 10441 / D)

KEGG orthology group: None (inferred from 83% identity to rme:Rmet_5347)

MetaCyc: 48% identical to thiosulfate dehydrogenase (Allochromatium vinosum)
Thiosulfate dehydrogenase. [EC: 1.8.2.2]

Predicted SEED Role

"Cytochrome c family protein"

MetaCyc Pathways

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.8.2.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YQD7 at UniProt or InterPro

Protein Sequence (260 amino acids)

>RR42_RS35465 cytochrome C (Cupriavidus basilensis FW507-4G11)
MLSAVSAPALSQPTTVPMPVPDEASIPKGPMGDAIKRGKALLTDTHKQLPGNVGNGLNCT
SCHLNAGTTAYASPWVGLTAVFPEYRSRSAKVNSLQERINDCFQRSMNGKPLPFDSAEMN
AILSYMKWLSTGVPTGTNVTGRGFEKIETSLVPDRVHGKAVYAAQCASCHGAEGQGTKNP
QGGYIFPPVWGKDSFNVGAGMARMYTAAAFVKHNMPLGQGGTLSAQDAVDVAAYFTQQPR
PDYAARVKDWPKGDRPKDAR