Protein Info for RR42_RS35340 in Cupriavidus basilensis FW507-4G11

Annotation: cell division protein FtsH

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 550 600 647 transmembrane" amino acids 9 to 27 (19 residues), see Phobius details amino acids 119 to 141 (23 residues), see Phobius details TIGR01241: ATP-dependent metallopeptidase HflB" amino acids 119 to 613 (495 residues), 743.8 bits, see alignment E=4.5e-228 PF00004: AAA" amino acids 208 to 340 (133 residues), 153.9 bits, see alignment E=6.6e-49 PF17862: AAA_lid_3" amino acids 364 to 407 (44 residues), 53.6 bits, see alignment 2.4e-18 PF01434: Peptidase_M41" amino acids 421 to 610 (190 residues), 229 bits, see alignment E=9.3e-72

Best Hits

Swiss-Prot: 82% identical to FTSH_RALPJ: ATP-dependent zinc metalloprotease FtsH (ftsH) from Ralstonia pickettii (strain 12J)

KEGG orthology group: K03798, cell division protease FtsH [EC: 3.4.24.-] (inferred from 85% identity to reu:Reut_C6194)

MetaCyc: 51% identical to ATP-dependent zinc metalloprotease FtsH (Escherichia coli K-12 substr. MG1655)
3.4.24.-

Predicted SEED Role

"Cell division protein FtsH (EC 3.4.24.-)" in subsystem Bacterial Cell Division (EC 3.4.24.-)

Isozymes

Compare fitness of predicted isozymes for: 3.4.24.-

Use Curated BLAST to search for 3.4.24.-

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YNQ4 at UniProt or InterPro

Protein Sequence (647 amino acids)

>RR42_RS35340 cell division protein FtsH (Cupriavidus basilensis FW507-4G11)
MEPRQQQFSLLYVLAAAVMMLAIQSYIGTSHIETLPYSDFKVLLKAGKLKNVALGEAAIT
GTLSTEGIDKFLPKQQVDEMLREGKGDHQFSTLRVNDPNLVQDLEAAKVRFVGEADSKWI
GVLLSWIVPALLFFAIWSFMIKRMGGAASGMLEIGKSKAKVYMQKETGVTFADVAGIDEA
KEELSEIVNFLKDPQRYRRLGGKIPKGVLLLGAPGTGKTLLAKAVAGEAGVPFFSLSGSD
FVEMFVGVGAARVRDLFNQAESKAPCIIFIDELDALGKTRAFNAMGGNEEREQTLNQLLV
EMDGFDTNKGVIIMAATNRPEILDPALLRPGRFDRHVALDRPDLKGREQILKVHVKNVVL
APTVELTKLAARTPGFAGADLANLVNEAALLAARKGEDAVEMTDFDEALDRIVGGLEKKN
RVMNPQEKETIAYHEAGHAIVAESRPRADRVSKVSIIPRGVAALGYTQQTPTEDRYLLKQ
SELLDRLDVLLGGRVAEQIAFGDVSTGAQNDLQRATDMARQMITQFGMSEQLGLATYEEM
RNPMFMGAGMMPRERKEYSESTAQMIDTEVRQILADANGRVKQTLLANRNKLDALAKLLL
EQEVVDRSALDLLLSDKVTPLTPGKHAAETAETPDPRTRNNEKNEGK