Protein Info for RR42_RS35090 in Cupriavidus basilensis FW507-4G11

Annotation: DSBA oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 450 500 537 transmembrane" amino acids 21 to 45 (25 residues), see Phobius details amino acids 57 to 76 (20 residues), see Phobius details amino acids 88 to 112 (25 residues), see Phobius details amino acids 118 to 138 (21 residues), see Phobius details amino acids 147 to 167 (21 residues), see Phobius details amino acids 177 to 197 (21 residues), see Phobius details amino acids 209 to 228 (20 residues), see Phobius details amino acids 238 to 257 (20 residues), see Phobius details amino acids 278 to 302 (25 residues), see Phobius details amino acids 314 to 333 (20 residues), see Phobius details amino acids 345 to 364 (20 residues), see Phobius details amino acids 370 to 393 (24 residues), see Phobius details amino acids 413 to 433 (21 residues), see Phobius details amino acids 489 to 510 (22 residues), see Phobius details PF07690: MFS_1" amino acids 27 to 422 (396 residues), 190.9 bits, see alignment E=4.7e-60 PF06609: TRI12" amino acids 40 to 449 (410 residues), 49.8 bits, see alignment E=3.1e-17 PF00083: Sugar_tr" amino acids 57 to 192 (136 residues), 30.5 bits, see alignment E=2.7e-11

Best Hits

KEGG orthology group: None (inferred from 80% identity to reh:H16_B2083)

Predicted SEED Role

"Permeases of the major facilitator superfamily"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YRH4 at UniProt or InterPro

Protein Sequence (537 amino acids)

>RR42_RS35090 DSBA oxidoreductase (Cupriavidus basilensis FW507-4G11)
MISHPHEAHSSGQVLPFRESLLAMLGIAFVVMLVALDQTVVGTALPTVVAELQGFEYYAW
VATAYLLMSVITVPIFGRLGDYYGRKPFVMVSIVVFTLASALCGMATSMPFLVLARGLQG
IGGGMLVGTAFACIPDLFPDSHVRLRWQVMMSAAFGIANAVGPSLGGVLTEAYGWRSVFY
VNLPVGLLGLWFAWRYLPHLRQQANTGAIKVDWLGAALIGVGLGGLQLCVELMPERGFGL
VTGGLLVMSVCALVGLWQWERRTPNPILPLEMFRNPGLAPLFLLAVFVGFAMFSLLLYAP
LLFQGGFGYSPKEAGVLVTPLVVCITVGSIINGRIITRIRQPNNMLYAGFGMLALACLGL
SQATRGMSHHLLLGMMLLCGFGLGFIMPNLTVFAQQTAGREHLGIATAMLQSLRMVGGMI
GTAVVGTLVTRSYLSGVHDALQSAGAGQWQARMADPQILIDRAAQARLLSQLEAAGHNGA
LLLEQARLSLVGAIHMGLALAAVIAVLGLWRSRRVPPIKLERAVKPVMATEQGGARG