Protein Info for RR42_RS35085 in Cupriavidus basilensis FW507-4G11

Annotation: MarR family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 154 PF12802: MarR_2" amino acids 32 to 88 (57 residues), 43.3 bits, see alignment E=6.8e-15 PF01047: MarR" amino acids 33 to 89 (57 residues), 47.5 bits, see alignment E=2.6e-16 PF13412: HTH_24" amino acids 36 to 79 (44 residues), 33.6 bits, see alignment E=4.6e-12 PF09339: HTH_IclR" amino acids 37 to 81 (45 residues), 26.2 bits, see alignment E=1.1e-09

Best Hits

KEGG orthology group: None (inferred from 83% identity to rme:Rmet_3937)

Predicted SEED Role

"Transcriptional regulator, MarR family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YNH5 at UniProt or InterPro

Protein Sequence (154 amino acids)

>RR42_RS35085 MarR family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MELERQSLAVLQQFGRTYRAYAAAFEQRIGHPLPRWRILSALYTHAGPIAQKPLAERVGM
DPGALTRQLKALQELGWVERNTSERDNRVTNVTLSALGHGVVEQALPLRSAFLQDVLENV
SETTMRNLSKGLEELEGGIAEAVLRTQQDKADAL