Protein Info for RR42_RS35030 in Cupriavidus basilensis FW507-4G11

Annotation: MFS transporter

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 436 transmembrane" amino acids 29 to 57 (29 residues), see Phobius details amino acids 70 to 91 (22 residues), see Phobius details amino acids 102 to 122 (21 residues), see Phobius details amino acids 125 to 125 (1 residues), see Phobius details amino acids 131 to 154 (24 residues), see Phobius details amino acids 166 to 189 (24 residues), see Phobius details amino acids 201 to 220 (20 residues), see Phobius details amino acids 255 to 280 (26 residues), see Phobius details amino acids 293 to 314 (22 residues), see Phobius details amino acids 321 to 341 (21 residues), see Phobius details amino acids 347 to 370 (24 residues), see Phobius details amino acids 382 to 405 (24 residues), see Phobius details amino acids 411 to 430 (20 residues), see Phobius details PF00083: Sugar_tr" amino acids 31 to 247 (217 residues), 81 bits, see alignment E=8.6e-27 amino acids 255 to 429 (175 residues), 23.8 bits, see alignment E=2e-09 PF07690: MFS_1" amino acids 45 to 395 (351 residues), 96.9 bits, see alignment E=1.2e-31

Best Hits

KEGG orthology group: None (inferred from 87% identity to reh:H16_B2072)

Predicted SEED Role

"L-Proline/Glycine betaine transporter ProP" in subsystem Proline, 4-hydroxyproline uptake and utilization

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YPZ9 at UniProt or InterPro

Protein Sequence (436 amino acids)

>RR42_RS35030 MFS transporter (Cupriavidus basilensis FW507-4G11)
MSTISSTAGADSAHSQQARPLTGQDYKTLALAALGGALEFYDFIIFVFFATVIGQLFFPP
SVPDWLRQLQTFGIFAAGYLARPLGGIIMAHFGDLLGRKKMFTLSILLMSVPTLLMGLLP
TYHAIGLLAPVALLLLRVMQGAAVGGEVPGAWVFVSEHVPARRTGYACGTLTAGLTAGIL
LGSLVATGVNTIFTPAELVDWGWRMPFLLGGVFGIGSMYLRRWLHETPVFAELQKRKALA
AEMPLKTVVRDHRGAVAVSMLLTWMLSAGIVVVILMTPTFLQKIYGFDARTALVANSVAT
LCLTVGCVVAGLMADKVGPRVTLFAGGLLLAISSYVFYSTLHTRPDLLIPLYAVAGFFVG
TIGAVPYVLVKAFPAQVRFSGLSFSYNLSYAIFGGLTPMIVTLMLKNDPLAPAYYVVALC
LLGMATALFVKDRSLA