Protein Info for RR42_RS34940 in Cupriavidus basilensis FW507-4G11

Annotation: bb3-type cytochrome oxidase subunit IV

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF00510: COX3
  • amino acids 36 to 227 (192 residues), 81.9 bits, E=3.5e-27

Best Hits

KEGG orthology group: K02276, cytochrome c oxidase subunit III [EC: 1.9.3.1] (inferred from 86% identity to reu:Reut_B3635)

Predicted SEED Role

"Alternative cytochrome c oxidase polypeptide CoxP (EC 1.9.3.1)" in subsystem Terminal cytochrome C oxidases (EC 1.9.3.1)

MetaCyc Pathways

• arsenite to oxygen electron transfer (2/2 steps found)
• aerobic respiration I (cytochrome c) (3/4 steps found)
• aerobic respiration II (cytochrome c) (yeast) (3/4 steps found)
• arsenite to oxygen electron transfer (via azurin) (2/3 steps found)
• Fe(II) oxidation (2/6 steps found)

KEGG Metabolic Maps

• Oxidative phosphorylation

Isozymes

Compare fitness of predicted isozymes for: 1.9.3.1

Use Curated BLAST to search for 1.9.3.1

Sequence Analysis Tools

See A0A0C4YPX7 at UniProt or InterPro

Protein Sequence (227 amino acids)

>RR42_RS34940 bb3-type cytochrome oxidase subunit IV (Cupriavidus basilensis FW507-4G11)
MSSLPTSSAPAVTGLRGLVADWSSDQRAFKVSWGKAMMWIFLLSDTFIFSCFLTGYMTVR
IASTAPWPNPSIVFGLKVGGTEVPLLLIAIMTFVLISSSGTMAMAVNFAYRRDRVKCALL
MFATALFGVAFVSMQAFEWTKLIVTEGVRPWGNPMGAPQFGSAFFMITGFHGLHVSCGVI
YLLIVATKVLRGRYERTGNYQIVEIAGLYWHFVDLVWVFIFALFYLW