Protein Info for RR42_RS34650 in Cupriavidus basilensis FW507-4G11

Annotation: LacI family transcriptional regulator

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 356 PF00356: LacI" amino acids 22 to 69 (48 residues), 41.5 bits, see alignment 1.9e-14 PF00532: Peripla_BP_1" amino acids 82 to 338 (257 residues), 109.7 bits, see alignment E=4e-35 PF13407: Peripla_BP_4" amino acids 83 to 295 (213 residues), 63.9 bits, see alignment E=3.7e-21 PF13377: Peripla_BP_3" amino acids 189 to 351 (163 residues), 129.2 bits, see alignment E=3.5e-41

Best Hits

KEGG orthology group: K02529, LacI family transcriptional regulator (inferred from 72% identity to reu:Reut_B5848)

Predicted SEED Role

"Transcriptional regulator, LacI family"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YN64 at UniProt or InterPro

Protein Sequence (356 amino acids)

>RR42_RS34650 LacI family transcriptional regulator (Cupriavidus basilensis FW507-4G11)
MACSHSSHTSLPARMDQRKRITLKDLAAKADVHYSTVSRVMNAATRHLVADEVAERILRM
ADELGFRPNRIAAGLRTKRSGLIGVVLPDISNPVFPPILAGLEGVLASRGYVPIVVNVGA
DKTRQRFVIDQMMGRQVDGLILATAEREDAVLDYCVKQNIPVVMVNRGEDIGRVPCVVSD
NLLGMRLAVDHLVALGHRRIGHIAGPDSLSTGHQRKQGFIDAVRRHKLRKDEWMIVEAAS
YGREAGREACRTLLARFPALTAIAAGNDLVALGCYDYLREAGIACPARVSVIGHNDMPFV
DALTPALTTIRIAVHEMGVQAATLLLARIENAKAEAASVVLRPELIVRGSTAPPAQ