Protein Info for RR42_RS34515 in Cupriavidus basilensis FW507-4G11

Annotation: acyltransferase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 380 transmembrane" amino acids 20 to 39 (20 residues), see Phobius details amino acids 58 to 77 (20 residues), see Phobius details amino acids 96 to 115 (20 residues), see Phobius details amino acids 139 to 161 (23 residues), see Phobius details amino acids 168 to 189 (22 residues), see Phobius details amino acids 201 to 219 (19 residues), see Phobius details amino acids 231 to 250 (20 residues), see Phobius details amino acids 257 to 276 (20 residues), see Phobius details amino acids 287 to 305 (19 residues), see Phobius details amino acids 325 to 346 (22 residues), see Phobius details PF01757: Acyl_transf_3" amino acids 17 to 341 (325 residues), 96.5 bits, see alignment E=1.7e-31

Best Hits

KEGG orthology group: None (inferred from 70% identity to bph:Bphy_2462)

Predicted SEED Role

"Lysophospholipid acyltransferase"

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YV66 at UniProt or InterPro

Protein Sequence (380 amino acids)

>RR42_RS34515 acyltransferase (Cupriavidus basilensis FW507-4G11)
MDYQASRDVNPTGRSIELDFVRGLAIIAVMGMHFHTVSTGSQWVALIEYPLKNFGREGVN
LFFTLSGFLVGGLLLRQYAHSGSVDARRFIIRRIFKIWPAYYALILFHVLAGRHPTSTFL
YQNLTHMQNYLGSSIAQTWSLAVEEHFYLFLPALVLLFARLRVRANTILWTLGALCVVVL
AARCAAVASGELEAASAYTQYRIDSLLIGVMLATVYWMKPELYRRIAGQKLLLLAVVAGT
VVWLVFLQRNLMLEESIGYTIQAIGFAALIVLVLEYSGAIRGARLYRAVAWIGVYSYGIY
LWHSVALAPGDVFIRKASAFGLPVMVAWGLALALQFAVAIIAGYAATRAIEFPFLRIRDA
LFPARRRSTPAAQPAEQHAA