Protein Info for RR42_RS34380 in Cupriavidus basilensis FW507-4G11

Annotation: dihydrolipoamide dehydrogenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 469 PF07992: Pyr_redox_2" amino acids 13 to 332 (320 residues), 129.1 bits, see alignment E=6.9e-41 PF01134: GIDA" amino acids 13 to 150 (138 residues), 21.8 bits, see alignment E=2.8e-08 PF00070: Pyr_redox" amino acids 180 to 232 (53 residues), 26.4 bits, see alignment 2.5e-09 PF02852: Pyr_redox_dim" amino acids 356 to 459 (104 residues), 56.9 bits, see alignment E=6.8e-19

Best Hits

KEGG orthology group: K00382, dihydrolipoamide dehydrogenase [EC: 1.8.1.4] (inferred from 82% identity to reh:H16_B1098)

Predicted SEED Role

"Dihydrolipoamide dehydrogenase (EC 1.8.1.4)" in subsystem Glycine cleavage system or Leucine Degradation and HMG-CoA Metabolism or Photorespiration (oxidative C2 cycle) or TCA Cycle (EC 1.8.1.4)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 1.8.1.4

Use Curated BLAST to search for 1.8.1.4

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Compare to protein structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YPM0 at UniProt or InterPro

Protein Sequence (469 amino acids)

>RR42_RS34380 dihydrolipoamide dehydrogenase (Cupriavidus basilensis FW507-4G11)
MQNVKTVQTIQTDVAVIGAGTAGLAAYRAARAAGKRAVIIEGGPYGTTCARVGCMPSKLL
IAAAEAAHELRHTAAFGVHVDGEIRIDGREVMARVKRERDRFVGFVVRGVDGIPAEDKVS
GYARFIDNTVLQVGEHTTVRASRVVIATGSSPVIPPPFKVFGDRLVVNDDVFAWDDLPRR
VAVFGPGVIGLELGQALSRLGVQVRVFGLRGGVGPLTDPAIKASAVASYREEFYLDPDAR
LGEMHRDGDEAVISFTDLSGNTVTERFDYVLAATGRQPNVRGLGLEHTGLALDWRGVPVF
DPATLQCGTAPIFIAGDANDVLPLLHEAADEGKAAGENAAAYPKVRPLSRRAPIGVVFTD
PQIAMVGQRHADIEPDSFVTGEVSFEDQGRSRVMLKNRGLMHVYADKASGRFLGAEWTGP
RAENIAHLLAWAYQQALTIDQMLAMPYYHPVVEEGLRTALRDAGAKLAG