Protein Info for RR42_RS34360 in Cupriavidus basilensis FW507-4G11

Annotation: transposase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 364 PF01385: OrfB_IS605" amino acids 166 to 266 (101 residues), 48.6 bits, see alignment E=9.2e-17 TIGR01766: transposase, IS605 OrfB family" amino acids 233 to 303 (71 residues), 30.2 bits, see alignment E=2.4e-11 PF07282: OrfB_Zn_ribbon" amino acids 278 to 351 (74 residues), 63 bits, see alignment E=2e-21

Best Hits

KEGG orthology group: None (inferred from 61% identity to pna:Pnap_4095)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YPL6 at UniProt or InterPro

Protein Sequence (364 amino acids)

>RR42_RS34360 transposase (Cupriavidus basilensis FW507-4G11)
MGTVKTLKLRIQDKHAKTMLAMARDVNTVWNFCNETQYRSLKRYCNKPKVWLSGFDLQKL
TAGFSKCEGVHVDSRTIQETCKEFATRLKQFKRQRLNWRVSDRKSPKYSLGWVPFKGEGI
EYRNGQLHFNGLKIGLWDSYGLSKYELGAGRFNEDSRGRWYVNIAVKVEVEEKRVPDGTT
TLGIDLGLKTAATYSDGSEFAMPKWYRLSEADLGIAQRANKKRRVKAIHARIANQRKDAI
HKETTALVKKHAAIFVGNVNAKAMAKTSMAKSVHDAAWTTFRTQLKYKAIRQCVVFEEVN
EAFSTQTCSCCGVIPPSSPKGRAGLGIRQWTCCACGAEHNRDTNAARNIARLGLQALEVG
ISGV