Protein Info for RR42_RS34195 in Cupriavidus basilensis FW507-4G11

Annotation: amino acid transporter LysE

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 203 signal peptide" amino acids 1 to 16 (16 residues), see Phobius details transmembrane" amino acids 17 to 28 (12 residues), see Phobius details amino acids 40 to 64 (25 residues), see Phobius details amino acids 69 to 91 (23 residues), see Phobius details amino acids 144 to 162 (19 residues), see Phobius details amino acids 184 to 201 (18 residues), see Phobius details PF01810: LysE" amino acids 16 to 199 (184 residues), 106 bits, see alignment E=9.4e-35

Best Hits

Swiss-Prot: 37% identical to Y136_VIBCH: Uncharacterized membrane protein VC_0136 (VC_0136) from Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961)

KEGG orthology group: None (inferred from 66% identity to bra:BRADO3764)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YUW7 at UniProt or InterPro

Protein Sequence (203 amino acids)

>RR42_RS34195 amino acid transporter LysE (Cupriavidus basilensis FW507-4G11)
MQLHTWLIFLATSIGMSLSPGPNGMLALTHGAMHGSRKTLFTIAGAVLGFVAVIGLCMFG
IGALIKASVVWLTALKWVGGAYLLWLGVQVWRAPPIAVTANTEPVKASGWSLFRQGALSA
ATNPKGMLFFSAFLPQFIDPQRNLVVQFAAVAATYAATEFLAEYAVASAAHRIRPWLERV
GRRFNRVCGGVFVLIGAALPLRA