Protein Info for RR42_RS34125 in Cupriavidus basilensis FW507-4G11

Annotation: NADPH:quinone reductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• TIGR02817: zinc-binding alcohol dehydrogenase family protein
  • amino acids 2 to 334 (333 residues), 491.5 bits, E=7.7e-152
• PF08240: ADH_N
  • amino acids 31 to 89 (59 residues), 29.3 bits, E=9.6e-11
• PF00107: ADH_zinc_N
  • amino acids 161 to 258 (98 residues), 34.1 bits, E=3.7e-12
• PF13602: ADH_zinc_N_2
  • amino acids 195 to 334 (140 residues), 48.7 bits, E=2.3e-16

Best Hits

KEGG orthology group: None (inferred from 60% identity to pae:PA3567)

Predicted SEED Role

"Bifunctional protein: zinc-containing alcohol dehydrogenase; quinone oxidoreductase ( NADPH:quinone reductase) (EC 1.1.1.-); Similar to arginate lyase" (EC 1.1.1.-)

KEGG Metabolic Maps

• Alkaloid biosynthesis I
• Aminosugars metabolism
• Ascorbate and aldarate metabolism
• Benzoate degradation via CoA ligation
• Biosynthesis of alkaloids derived from shikimate pathway
• Biosynthesis of type II polyketide products
• Biosynthesis of unsaturated fatty acids
• Bisphenol A degradation
• Butanoate metabolism
• C21-Steroid hormone metabolism
• Fructose and mannose metabolism
• Glycine, serine and threonine metabolism
• Insect hormone biosynthesis
• Linoleic acid metabolism
• Nucleotide sugars metabolism
• Polyketide sugar unit biosynthesis
• Retinol metabolism
• Tetrachloroethene degradation

Isozymes

Compare fitness of predicted isozymes for: 1.1.1.-

Use Curated BLAST to search for 1.1.1.-

Sequence Analysis Tools

See A0A0C4YF26 at UniProt or InterPro

Protein Sequence (337 amino acids)

>RR42_RS34125 NADPH:quinone reductase (Cupriavidus basilensis FW507-4G11)
MKAIGFYQNHPISHPQALQDIELPTPELRDHDLLVEVKAVSVNPVDTKIRRGGDIPEGHA
RIAGWDAAGIVRATGPLATRFKPGDRVWYAGDITRPGSNSELHAVDERIVGPMPASLDFA
QAASLPLTAITAWELLFDRLRVQAADPTDNNVLLITGAAGGVGSILTQLARTLTGMTVIG
TASRPDTREWVLAHGAHHVIDHHQPWAPQLAALGIEHVTHVAGLNQSAIHVPQIAAVLRP
EGQFALIDDPVDLDIGPFKGKSISIHWELMFTRAMFTTDTIARQHALLRRVAELVDRGDI
KHTLTQRIDGINAASLIEAHALVEAGNMIGKVVVANP