Protein Info for RR42_RS33940 in Cupriavidus basilensis FW507-4G11

Annotation: naphthalene 1,2-dioxygenase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

• PF13806: Rieske_2
  • amino acids 4 to 101 (98 residues), 49 bits, E=5.3e-17
• PF00355: Rieske
  • amino acids 4 to 90 (87 residues), 62.8 bits, E=2.4e-21

Best Hits

Swiss-Prot: 55% identical to NDOA_PSEAI: Naphthalene 1,2-dioxygenase system, ferredoxin component (ndoA) from Pseudomonas aeruginosa

KEGG orthology group: K14578, naphthalene 1,2-dioxygenase system ferredoxin subunit (inferred from 68% identity to bug:BC1001_0578)

MetaCyc: 57% identical to 2,4-dinitrotoluene dioxygenase complex ferredoxin component (Burkholderia sp. DNT)
RXN-8820 [EC: 1.14.12.24]

Predicted SEED Role

"Ferredoxin" in subsystem Soluble cytochromes and functionally related electron carriers

MetaCyc Pathways

• 2,4-dinitrotoluene degradation (2/7 steps found)

Isozymes

No predicted isozymes

Use Curated BLAST to search for 1.14.12.24

Sequence Analysis Tools

See A0A0C4YQP4 at UniProt or InterPro

Protein Sequence (103 amino acids)

>RR42_RS33940 naphthalene 1,2-dioxygenase (Cupriavidus basilensis FW507-4G11)
MSKQWTQVIPLVAIPKDDVVAVNALGKEIALYSVGDAIYATDNACSHGNARLCDGFLDGH
EIECPLHQGKFDVRTGRAMCEPLTSDIQAYSVKVENGAVFVEL