Protein Info for RR42_RS33935 in Cupriavidus basilensis FW507-4G11
Annotation: salicylate hydroxylase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 62% identical to NAGH_RALSP: Salicylate 5-hydroxylase, small oxygenase component (nagH) from Ralstonia sp.
KEGG orthology group: K05709, small terminal subunit of phenylpropionate dioxygenase [EC: 1.14.12.19] (inferred from 79% identity to bug:BC1001_0577)MetaCyc: 62% identical to salicylate-5-hydroxylase small subunit (Ralstonia sp. U2)
RXN-10446 [EC: 1.14.13.172]
Predicted SEED Role
"Ortho-halobenzoate 1,2-dioxygenase beta-ISP protein OhbA" in subsystem Benzoate degradation
MetaCyc Pathways
- salicylate degradation II (1/1 steps found)
- 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation (6/8 steps found)
- salicylate glucosides biosynthesis II (1/2 steps found)
- 3-phenylpropanoate and 3-(3-hydroxyphenyl)propanoate degradation to 2-hydroxypentadienoate (3/5 steps found)
- cinnamate and 3-hydroxycinnamate degradation to 2-hydroxypentadienoate (3/5 steps found)
KEGG Metabolic Maps
Isozymes
Compare fitness of predicted isozymes for: 1.14.12.19
Use Curated BLAST to search for 1.14.12.19 or 1.14.13.172
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4YMR8 at UniProt or InterPro
Protein Sequence (157 amino acids)
>RR42_RS33935 salicylate hydroxylase (Cupriavidus basilensis FW507-4G11) MLDFETYTQVLALYTDYACALDNNEWEKWPGFFTEACVYKLQPRENHEAGLPLATLCFES RGMLKDRIYGATETIFHDPYYQRHVVGIPRILNADAQRIDAEASYAVFRTKPDGQTTVYN VGRYIDVIRRTGDGLKFESRLCVFDSEMIANSIIYPI