Protein Info for RR42_RS33895 in Cupriavidus basilensis FW507-4G11

Annotation: membrane protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 305 signal peptide" amino acids 1 to 26 (26 residues), see Phobius details TIGR01730: efflux transporter, RND family, MFP subunit" amino acids 46 to 235 (190 residues), 122.3 bits, see alignment E=1e-39 PF16576: HlyD_D23" amino acids 46 to 237 (192 residues), 40 bits, see alignment E=5.5e-14 PF13533: Biotin_lipoyl_2" amino acids 47 to 93 (47 residues), 63.2 bits, see alignment 3e-21 PF13437: HlyD_3" amino acids 156 to 237 (82 residues), 37 bits, see alignment E=9.5e-13

Best Hits

Swiss-Prot: 42% identical to YDHJ_ECOLI: Uncharacterized protein YdhJ (ydhJ) from Escherichia coli (strain K12)

KEGG orthology group: None (inferred from 72% identity to rme:Rmet_4791)

Predicted SEED Role

"Membrane fusion component of tripartite multidrug resistance system" in subsystem Multidrug Resistance, Tripartite Systems Found in Gram Negative Bacteria

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YPA9 at UniProt or InterPro

Protein Sequence (305 amino acids)

>RR42_RS33895 membrane protein (Cupriavidus basilensis FW507-4G11)
MKFKFRLLVPVMLTLLATVAALVVGKHLWDYYTVAPWTRDGHVRADVVQVAPDVSGLVTQ
ILVKDNQRVRRGQVLFVIDQDRYQLALRQAMASAAAQRATLAQARREAARSHALSEVVAT
EVVEEGQARVQQGEAALAQAEAAVALARLNLARTRVASPVDGFLNDRLPRLGDYVVLGRP
VLSMVDLNSFYVEGYFEETKLGGIRIGNPVSVRIMGERTILHGHVQSIAAGIEDRDRSNG
TSLLPNVNPTFNWVRLAQRVPVRIVLDDVPADVRLVSGRTATVSVAQPRNTIAVLRDETT
QESAQ