Protein Info for RR42_RS33880 in Cupriavidus basilensis FW507-4G11
Annotation: serine dehydratase
These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.
Protein Families and Features
Best Hits
Swiss-Prot: 52% identical to SDSL_MOUSE: Serine dehydratase-like (Sdsl) from Mus musculus
KEGG orthology group: None (inferred from 67% identity to bur:Bcep18194_A4400)MetaCyc: 52% identical to L-serine dehydratase (Homo sapiens)
Threonine ammonia-lyase. [EC: 4.3.1.19]; L-serine ammonia-lyase. [EC: 4.3.1.19, 4.3.1.17]
Predicted SEED Role
No annotation
MetaCyc Pathways
- superpathway of branched chain amino acid biosynthesis (17/17 steps found)
- superpathway of L-isoleucine biosynthesis I (13/13 steps found)
- superpathway of L-lysine, L-threonine and L-methionine biosynthesis II (13/15 steps found)
- superpathway of L-threonine metabolism (15/18 steps found)
- L-isoleucine biosynthesis I (from threonine) (7/7 steps found)
- D-serine degradation (3/3 steps found)
- L-serine degradation (3/3 steps found)
- glycine degradation (3/3 steps found)
- L-methionine biosynthesis II (5/6 steps found)
- L-threonine degradation I (5/6 steps found)
- L-cysteine degradation II (2/3 steps found)
- L-methionine degradation II (2/3 steps found)
- L-tryptophan degradation II (via pyruvate) (2/3 steps found)
- L-threonine degradation V (1/2 steps found)
- glycine betaine degradation I (5/8 steps found)
- glycine betaine degradation III (4/7 steps found)
- purine nucleobases degradation II (anaerobic) (16/24 steps found)
- felinine and 3-methyl-3-sulfanylbutan-1-ol biosynthesis (2/5 steps found)
- L-mimosine degradation (4/8 steps found)
- glutathione-mediated detoxification I (3/8 steps found)
- hypoglycin biosynthesis (4/14 steps found)
- cyclosporin A biosynthesis (2/15 steps found)
KEGG Metabolic Maps
- Cysteine metabolism
- Glycine, serine and threonine metabolism
- Valine, leucine and isoleucine biosynthesis
Isozymes
Compare fitness of predicted isozymes for: 4.3.1.17, 4.3.1.19
Use Curated BLAST to search for 4.3.1.17 or 4.3.1.19
Sequence Analysis Tools
PaperBLAST (search for papers about homologs of this protein)
Search CDD (the Conserved Domains Database, which includes COG and superfam)
Predict protein localization: PSORTb (Gram-negative bacteria)
Predict transmembrane helices and signal peptides: Phobius
Check the current SEED with FIGfam search
Find homologs in fast.genomics or the ENIGMA genome browser
See A0A0C4YEZ0 at UniProt or InterPro
Protein Sequence (314 amino acids)
>RR42_RS33880 serine dehydratase (Cupriavidus basilensis FW507-4G11) MPHANNALPASLHIVTPLLRSTSFSARLGRSVWFKMEALQPPGSFKARGIGHACQTYKEW GAKRLVCSSGGNAGIAVAYSGRLLGVPVTVVVPETTSAAARERIAAEGAELVVYGRAWSE ANDHALSLMRPEYAFIHPFDDPLLWEGHATMIDEVAAAGVKPGAVVLSVGGGGLLCGVLA GLERNGWHDVPVIAAETVGADSYAASLAAGAQVELPAITSIATSLGARSPCAKALEWSKV HSIVSEVVTDKEAVGACLRFLAEHRIVVEPACGAALAALERKPAAVTAASDVLVIVCGGA GATAEQLQAWDRGA