Protein Info for RR42_RS33770 in Cupriavidus basilensis FW507-4G11

Annotation: cobalamin biosynthesis protein CobS

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 325 PF12556: CobS_N" amino acids 4 to 36 (33 residues), 56.4 bits, see alignment 1.9e-19 PF07728: AAA_5" amino acids 63 to 189 (127 residues), 38.5 bits, see alignment E=1.1e-13

Best Hits

Swiss-Prot: 66% identical to COBS_SINSX: Aerobic cobaltochelatase subunit CobS (cobS) from Sinorhizobium sp.

KEGG orthology group: K09882, cobaltochelatase CobS [EC: 6.6.1.2] (inferred from 90% identity to bpy:Bphyt_4365)

MetaCyc: 66% identical to CobS (Pseudomonas denitrificans (nom. rej.))

Predicted SEED Role

"Aerobic cobaltochelatase CobS subunit (EC 6.6.1.2)" in subsystem Coenzyme B12 biosynthesis or Conenzyme B12 related Hypothetical: Clusters with cobST (EC 6.6.1.2)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 6.6.1.2

Use Curated BLAST to search for 6.6.1.2

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YQK9 at UniProt or InterPro

Protein Sequence (325 amino acids)

>RR42_RS33770 cobalamin biosynthesis protein CobS (Cupriavidus basilensis FW507-4G11)
MDIVTGKPDKMVAARTLFGIDSGLMVPAFSERDDHVPEIDEAYRFNPEVTLAILAGFTRD
RRVMVQGLHGTGKSTHIEQVAARLNWPCVRVNLDGHISRLDLVGKDAIVVRDGRQVTEFQ
EGIVPWALQRPVALIFDEYDAGRPDVMFVIQRMLERDGKFTLLDQNRVIHPHPAFRMFAT
ANTVGLGNLNGLYHGTQMLNHAQMDRWNVVATLNYLPRAQEAGIVLARVPELADDAGRAL
IASMVSVAELTRKGFATGDLSTLMSPRTVISWAENCQIFRDPALAFRLSFLNKCDDAERP
IVGEYFQRCFGREVEAAQGDAAQPC