Protein Info for RR42_RS33730 in Cupriavidus basilensis FW507-4G11

Annotation: hypothetical protein

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 300 350 400 429 TIGR01060: phosphopyruvate hydratase" amino acids 4 to 424 (421 residues), 632.4 bits, see alignment E=1.5e-194 PF03952: Enolase_N" amino acids 4 to 132 (129 residues), 174.5 bits, see alignment E=1.1e-55 PF00113: Enolase_C" amino acids 140 to 423 (284 residues), 419 bits, see alignment E=1.1e-129

Best Hits

Swiss-Prot: 68% identical to ENO_THISH: Enolase (eno) from Thioalkalivibrio sulfidiphilus (strain HL-EbGR7)

KEGG orthology group: K01689, enolase [EC: 4.2.1.11] (inferred from 68% identity to tgr:Tgr7_1184)

MetaCyc: 62% identical to enolase (Synechococcus elongatus PCC 7942 = FACHB-805)
Phosphopyruvate hydratase. [EC: 4.2.1.11]

Predicted SEED Role

"Enolase (EC 4.2.1.11)" in subsystem Entner-Doudoroff Pathway or Glycolysis and Gluconeogenesis or Glycolysis and Gluconeogenesis, including Archaeal enzymes or Serine-glyoxylate cycle (EC 4.2.1.11)

MetaCyc Pathways

KEGG Metabolic Maps

Isozymes

Compare fitness of predicted isozymes for: 4.2.1.11

Use Curated BLAST to search for 4.2.1.11

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YUL7 at UniProt or InterPro

Protein Sequence (429 amino acids)

>RR42_RS33730 hypothetical protein (Cupriavidus basilensis FW507-4G11)
MTVIRSIRGFEVLDSRGNPTVAAEVTLADGARGYAAAPSGASTGSREALELRDNDPARYG
GKGVRQAVRHVNEDLGATLAGCDAADQAAVDGLLLQADGTETKSRMGANALLAVSLAAAR
AAAASQRVPLYRRFSMADRFVLPVPMMNVINGGAHADNNVDIQEFMILPAGATSFAEAIR
WGAEVFHSLKSVLRKRGLSTAVGDEGGFAPDLPSNEAALEAIVGAIELAGFRVGPDIALG
LDVASSELYENGVYSLASEGKRFDAGGFCDYLAALAKNYPIVTIEDGMAEDDWTGWKLLT
ETLGERIQLVGDDLFVTNTAILERGIKEGIANSVLIKPNQIGTLTETLAAISMATAAGYA
AVISHRSGETEDTTIADIAVGTSATQIKTGSLCRSDRVAKYNRILLIEAELGELATYAGS
TAFAQRQAG