Protein Info for RR42_RS33625 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 280 transmembrane" amino acids 6 to 24 (19 residues), see Phobius details amino acids 31 to 49 (19 residues), see Phobius details amino acids 54 to 74 (21 residues), see Phobius details amino acids 83 to 107 (25 residues), see Phobius details amino acids 127 to 145 (19 residues), see Phobius details amino acids 178 to 198 (21 residues), see Phobius details amino acids 214 to 240 (27 residues), see Phobius details amino acids 251 to 268 (18 residues), see Phobius details PF02653: BPD_transp_2" amino acids 3 to 263 (261 residues), 92.6 bits, see alignment E=1.2e-30

Best Hits

KEGG orthology group: None (inferred from 40% identity to bbt:BBta_5241)

Predicted SEED Role

"Branched-chain amino acid transport system permease protein LivM (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

Find the best match in UniProt

Protein Sequence (280 amino acids)

>RR42_RS33625 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MLVEFFYFVALAQLWNILAGYGGFMSLGQQAYLGSGGYVLFALAIFFKMPPLASIVLAGL
CAAGMACIVAFAVFRLAGPYLAIGTWVIAEVFRLAFSQASALGAGSGISIPLDAVRSLDL
GWMSRDMLLYLIALLLAVAVNYGAYRMLRSKYGLALCAIRDNESAASTMGIHQRHLKFAV
YIVVSAAYGMLGAFIFLTKLRISPASAFDINWTGYIIFIVVIGGIGTLEGPIIGCIIYFV
MRQYLADTGSTYLILLGLIGIVVMRFYPRGIWGELAARHG