Protein Info for RR42_RS33620 in Cupriavidus basilensis FW507-4G11

Annotation: ABC transporter permease

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 250 290 transmembrane" amino acids 12 to 31 (20 residues), see Phobius details amino acids 37 to 56 (20 residues), see Phobius details amino acids 62 to 80 (19 residues), see Phobius details amino acids 92 to 114 (23 residues), see Phobius details amino acids 136 to 161 (26 residues), see Phobius details amino acids 190 to 211 (22 residues), see Phobius details amino acids 225 to 251 (27 residues), see Phobius details amino acids 263 to 284 (22 residues), see Phobius details PF02653: BPD_transp_2" amino acids 8 to 275 (268 residues), 82.9 bits, see alignment E=1.1e-27

Best Hits

KEGG orthology group: K01997, branched-chain amino acid transport system permease protein (inferred from 60% identity to rlg:Rleg_5536)

Predicted SEED Role

"High-affinity branched-chain amino acid transport system permease protein LivH (TC 3.A.1.4.1)" in subsystem ABC transporter branched-chain amino acid (TC 3.A.1.4.1) (TC 3.A.1.4.1)

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YML8 at UniProt or InterPro

Protein Sequence (290 amino acids)

>RR42_RS33620 ABC transporter permease (Cupriavidus basilensis FW507-4G11)
MTDWIDVIVQGMLLGGLYALYASGLSLIFGVMRLVNVAHGDLIVLAAFLAFAIRIPGAET
SFASLLLTVPVMFAIGYVLQRALLNGAMGANVLRPMLLTFGLSIVLQNGLLEVFSADARK
LPGGAIETMSLPLGNGIAVGILPVITLLAAIAVLGALQFMLRRTAIGRAFRATSDDAEAA
GWMGINHRNLFALATGMSMAVVGIAAVFMGTRASFDPASGPDRLIFAFEAVVIGGLGSLW
GTLAGGIALGVAQSVGASLDPDWQLLAGHLLFLLVLLIAPNGIFPQRGNQ