Protein Info for RR42_RS33600 in Cupriavidus basilensis FW507-4G11

Annotation: oxidoreductase

These analyses and tools can help you predict a protein's function, but be skeptical. For enzymes, over 10% of annotations from KEGG or SEED are probably incorrect. For other types of proteins, the error rates may be much higher. MetaCyc and Swiss-Prot have low error rates, but the best hits in these databases are often quite distant, so this protein's function may not be the same. TIGRFam has low error rates. Finally, many experimentally-characterized proteins are not in any of these databases. To find relevant papers, use PaperBLAST.

Protein Families and Features

1 50 100 150 200 262 PF00106: adh_short" amino acids 13 to 203 (191 residues), 140.8 bits, see alignment E=6e-45 PF08659: KR" amino acids 16 to 176 (161 residues), 70.2 bits, see alignment E=3.2e-23 PF13561: adh_short_C2" amino acids 22 to 260 (239 residues), 170.1 bits, see alignment E=9.2e-54

Best Hits

Swiss-Prot: 58% identical to Y1714_MYCTO: Uncharacterized oxidoreductase MT1753.1 (MT1753.1) from Mycobacterium tuberculosis (strain CDC 1551 / Oshkosh)

KEGG orthology group: None (inferred from 55% identity to pat:Patl_2324)

Predicted SEED Role

No annotation

Sequence Analysis Tools

PaperBLAST (search for papers about homologs of this protein)

Search CDD (the Conserved Domains Database, which includes COG and superfam)

Search structures

Predict protein localization: PSORTb (Gram-negative bacteria)

Predict transmembrane helices and signal peptides: Phobius

Check the current SEED with FIGfam search

Find homologs in fast.genomics or the ENIGMA genome browser

See A0A0C4YQH2 at UniProt or InterPro

Protein Sequence (262 amino acids)

>RR42_RS33600 oxidoreductase (Cupriavidus basilensis FW507-4G11)
MASTSAAFGLSGKVGVITGATGAFGRAAARSLADAGARLVIAGANAQALRELEMQLNADG
IRVKAKACRPDTEANARNLIDEAVAQFGAIDFVVVGSGTNDPAPIQDMTTEQWEHVMAAN
VRGSWLVCKAFATHCIETAQRGRVVLLSSTRGKLGLAAGYSAYCPSKAAIDGLTRTLACE
LGRYGINVNAIAPTVFRSELTAWMFADDDRGRAAREGMLARIPLGRLGEPEDLVGALQFL
LSRASEFCTGQTLYIDGGYTAG